KEGG   Brucella abortus bv. 9 C68: DK53_218Help
Entry
DK53_218          CDS       T03474                                 

Gene name
tenA
Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
babu  Brucella abortus bv. 9 C68
Pathway
babu00730  Thiamine metabolism
babu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:babu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DK53_218 (tenA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:babu03000]
    DK53_218 (tenA)
Enzymes [BR:babu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     DK53_218 (tenA)
Transcription factors [BR:babu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    DK53_218 (tenA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 NUDIX_4
Motif
Other DBs
NCBI-ProteinID: AIJ61717
Position
1:complement(236783..237481)
Genome map
AA seq 232 aa AA seqDB search
MNLPQPHYSSELFTRLRTATLADWKPYIEHDFVRGLGDGTLPKAAFLHYLRQDYVYLHHY
ARAFALGVVKANTSQETRLCADIMHSLTHMELPLHVRICAREGISEDALYATREEPENLA
YTRYVLDCGQAGDFLDLLTALVPCAHGYGEIGLNLAATARAGTPYQEWIDTYAGSEYQDM
CRTVGRLFDQAARDRIGDDFEKSPRWPKLCQIFATASRLEADFWSMGLKAGS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgccacagccgcattactcatccgaacttttcacgcgccttcgcactgccacg
cttgccgactggaagccctatatcgagcacgacttcgtgcgggggcttggcgacggcacg
ctaccgaaagccgccttcctgcattatctccggcaggattatgtctatctgcatcattat
gcccgcgcctttgcgctgggcgtggtcaaggccaatacatcgcaggaaacgcggctttgc
gccgacatcatgcacagtctcacccatatggaactgcctttgcatgtgcgcatctgcgcc
cgtgaaggcatcagcgaagacgcgctttacgccacgcgggaggaaccggaaaaccttgct
tatacgcgctatgtgctcgattgcggacaggcaggcgattttctcgatctgctgacagca
cttgtgccttgcgcgcacggctatggcgagatcggcctcaaccttgccgccacggccagg
gcgggcacgccctatcaggaatggatcgatacctatgccgggtctgaatatcaggacatg
tgccgcacggtcggcaggcttttcgatcaggccgcaagggaccgcatcggcgacgatttc
gagaaaagcccgcgctggccaaaactctgccagatttttgccacggcaagcaggctcgaa
gccgatttctggtccatgggcttgaaggccggatcgtga

DBGET integrated database retrieval system