KEGG   Brucella abortus bv. 9 C68: DK53_2232Help
Entry
DK53_2232         CDS       T03474                                 

Definition
(GenBank) amidase family protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
babu  Brucella abortus bv. 9 C68
Pathway
babu00970  Aminoacyl-tRNA biosynthesis
babu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:babu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DK53_2232
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:babu03029]
    DK53_2232
Enzymes [BR:babu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DK53_2232
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DK53_2232
Mitochondrial biogenesis [BR:babu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DK53_2232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase DUF1168
Motif
Other DBs
NCBI-ProteinID: AIJ62366
Position
2:161059..161613
Genome map
AA seq 184 aa AA seqDB search
MLLAKTTMPDLGMLSSGLSSFHKLARNPWDIATNPGGSSAGAGSAAAAGYGPLHIGTDIG
GSVRLPAGWCGLVGLKPSFGRIPIDPPFLGRVAGPMTRTVADNALYMSVLSRPDRRDGMS
LPYQDIDWMNLDIEVKGLKIGLWLDAGFDEPVGGEPVPPWKPQPNCLPMQARSSSRWRHS
SIAP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcttgccaagaccaccatgcccgatctcggcatgttgtcgtcgggcctgtcgagt
tttcacaagctggcccgcaatccgtgggatattgccaccaatcccggcggttcaagcgct
ggcgcgggaagtgccgccgccgccggttacggcccgctccatatcggcacggatattggc
ggctccgtccgcctgcctgccggctggtgcggtctggtcggcctgaagccatccttcggg
cgcattcccatcgatccgccgtttctggggcgcgttgccgggcctatgacgcgcactgtg
gccgataacgcgctttatatgtcggtgctgtcgcggccggatcggcgtgatggcatgagc
ctgccctatcaggatatcgactggatgaacctcgacatcgaagtgaagggcttgaagatc
ggcctttggctcgatgccggttttgacgagccggtggggggggaacccgtgccgccgtgg
aagccgcagccaaactgtttgccgatgcaggcgcgatcatcgagccggtggcgccattcc
tcaatcgcaccatga

DBGET integrated database retrieval system