KEGG   Brucella abortus bv. 9 C68: DK53_2433Help
Entry
DK53_2433         CDS       T03474                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
babu  Brucella abortus bv. 9 C68
Pathway
babu00071  Fatty acid degradation
babu00072  Synthesis and degradation of ketone bodies
babu00280  Valine, leucine and isoleucine degradation
babu00310  Lysine degradation
babu00362  Benzoate degradation
babu00380  Tryptophan metabolism
babu00620  Pyruvate metabolism
babu00630  Glyoxylate and dicarboxylate metabolism
babu00640  Propanoate metabolism
babu00650  Butanoate metabolism
babu00900  Terpenoid backbone biosynthesis
babu01100  Metabolic pathways
babu01110  Biosynthesis of secondary metabolites
babu01120  Microbial metabolism in diverse environments
babu01130  Biosynthesis of antibiotics
babu01200  Carbon metabolism
babu01212  Fatty acid metabolism
babu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:babu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DK53_2433
   00630 Glyoxylate and dicarboxylate metabolism
    DK53_2433
   00640 Propanoate metabolism
    DK53_2433
   00650 Butanoate metabolism
    DK53_2433
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK53_2433
   00072 Synthesis and degradation of ketone bodies
    DK53_2433
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DK53_2433
   00310 Lysine degradation
    DK53_2433
   00380 Tryptophan metabolism
    DK53_2433
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DK53_2433
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DK53_2433
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK53_2433
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:babu04147]
    DK53_2433
Enzymes [BR:babu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DK53_2433
Exosome [BR:babu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DK53_2433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIJ62088
Position
2:373998..375206
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANS
WEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALGQLSPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRNLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacgccgcgcgggcgcggcaagaaggac
ggctccctgcacgaagtgcctgccgttcgtctgggcgcgaaggttctggaatccctgcgc
gaccgcaacggcatcgacaccgccaaggtcgatgacattattttcggctgcgtcgatccg
gtcggcgaagcaggcgcggtcattccgcgttcggcggctttcgaggccggttatgatttc
aaggcgccgggcatccagatttcgcgcttctgcgcttcgggccttgatgccatcaatctg
gccgctgccaaggtggcattcggttcggatgatctggtgattgcgggcggcgtggaaagc
atgtcgcgcgtcggcatgggcatgtcgggcggcgcctggtacatggacccatcggttggc
ttccccggctatttcatgccgcagggcgtttccgccgacctgattgccaccaaatacggt
ttcagccgcgatgatgtcgatgcctatgctgtcgaaagccagaagcgcgctgccaattcg
tgggaaaagggctatttcaagaattcggtcatcacgatcaaggaccagaacggcctcacc
attctcgaccgtgacgagcatatgcgccccggcaccgacatgcaggcgctgggccagttg
agcccgtccttcgtgatgccgggcgaaatgggtggcttcaatgctgtcggcattcaggcg
cacccggaaatcgaaaccgtcaaccatgtccaccatgccggcaattcgtcgggcatcgtg
gatggcgcggcgggggttctcgtcggctccaggaaggctggcaaggccttcgatatcaag
ccgcgcgcgcgcattcgtgcttttgccaatatcggttcggaaccggcgcttatgctgacc
ggcccggtcgatgtgacggaaaagctgctgaaacaggccaagatgaagatttcggacatt
gatctgttcgagttgaacgaagccttcgccgcggtggtcctgcgctatatgcaggctttc
gatattccgcacgacaagatcaacgtcaatggcggcgccattgccatgggccatccgctc
ggtgccaccggcgcgatgatcctcggcacggtgctggatgaactggaacgccgcaatctc
aataccgctctggtgacgctgtgcatcggtgccggtatgggcacggccacgatcatcgag
cgcgtgtaa

DBGET integrated database retrieval system