KEGG   Burkholderia ambifaria MC40-6: BamMC406_0383Help
Entry
BamMC406_0383     CDS       T00684                                 

Definition
(GenBank) type VI secretion system Vgr family protein
Organism
bac  Burkholderia ambifaria MC40-6
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr DUF3540 Sarcoglycan_1
Motif
Other DBs
NCBI-ProteinID: ACB62882
UniProt: B1YS80
Position
1:430361..433534
Genome map
AA seq 1057 aa AA seqDB search
MNMQNTIAALRGGLLQQDRLLKLDTPLGANVLTVQRAVGRSRIGRAYEFTLDVLSADGDL
ELKKLIAQPVTLWIQQGDRSYRPVNGYVHTARRLGADGGLTTYQLTFADFTHFLKFRRDQ
RLWNDTSVDQIISDVLNQHPQAQGHFRFALSKPLPSRSYTRQHDTDWHFVHRLMESEGLY
STWQQADDGKSHTLVITDNLQAFASLSPETLRFYRGGAASEADAFTQWSGTRTLQSVTRT
TRTFDYKNPSQPSNPKGTTLPTMGGQGELPDQLEVYEYTGAYTYLDQTRGDHLTKIHMEE
WESQAKRFHGAGGVRAIDAGRRFVLSDHPEHDRDPADQREFAAIGVEWWIENNLPVASSS
ADFPYSLREALTQAQEGYGADPAFRVPHDDGSVGFYLVEVEAQRVSVPYRSPFEHEKPKM
HLETAIVVGPQGEEVYTDALNRIRVQFVWDRLNPGNENASCWVRVVQSDTGGGYGGVHVP
RIGEEVLIDYVGGDCDRPLAVGRVYNGANQPQWHSDGILSGYRSKEYSGGGYNQLVMDDA
TGQNRVQLMSSSANSLLHLGYIIDQNGNSRGSYLGSGFDLRSDAYGAVRASQGLYVTTHP
KAPNSQPLDVKEAQQQLVTGESLVEAMSGVSEQHQAESLKDAQDTMRAFTDATQNNVSGN
TSGGRTADGGTGSANAFKEPVMLFGSPSGIGMSTQQSLHMVANDHVNVASGQSVHVAAGK
SLIGSIGQKLSLFVQNAGMKLFAGKGKVEIQAQSDNVEVTAQKAVKVVSATDRIEIAADQ
GILLTSGGGYIRIQGGNIEIHTPGAVDVKGASHTFAGPASMGYPLPSPRPDQPGQLELFH
KYVNGEAVKGGLFTVKDVNGAVLKKGALDNSGYTVVSGLPPGAVRVEFGKDPRESDQPAN
YFKQAKWPAEPVEPSPEAAQAAASGQLASQLQGMAPAATTAAMGLVSGGSAGAALGGLAS
SALPAAASALGGAGAASALQTASSLSGAAKQVAGMVQAARQGGLAALAAPAANAASGALQ
GALPGVAGIAGKGATTVASAAGGMKLPTPGFGGPLKS
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcagaatacgattgccgcattgcgcggcgggttgcttcagcaggaccggctg
ctgaagctcgatacgccattgggggccaacgtgctgaccgtgcagcgtgcggtcggccgt
tcgcgcatcgggcgcgcatacgaattcacgctcgacgtgctgtcggccgatggtgatctg
gaactcaaaaaactgatcgcgcagcccgtcacgttgtggatccagcaaggcgatcgcagc
taccggccggtcaacggctacgtccataccgcgcgccgcctcggcgccgacggcgggctc
acgacctatcagctcacgttcgccgatttcacccatttcctgaagtttcgtcgcgaccag
cgcctctggaacgacacgagcgtcgatcagatcatcagcgatgtgctgaatcagcatccg
caggcgcaggggcattttcggttcgcgctgtcgaagccgctgccgagccggtcatacacg
cgtcagcacgataccgactggcatttcgtgcaccggctgatggaaagcgaaggcctctac
agcacgtggcagcaggccgacgacggcaagtcgcatacgctcgtgatcaccgacaacctg
caagcgttcgcgtcgctgtcgccggaaaccctgcgcttctatcgtggcggcgcggcgagc
gaagccgacgcgttcacgcaatggtcgggcacgcgcacgctgcagagcgtgacgcggacg
acgcgcacgttcgactacaagaatccatcgcaaccgtcgaacccgaagggcacgacgctg
ccgacgatgggtggccagggcgaattgcccgatcagctcgaggtctacgagtacaccggg
gcgtacacctatctggaccagacgcgcggcgaccatctgacgaagatccacatggaggaa
tgggagtcgcaggcgaagcgcttccatggcgcgggcggcgtgcgcgcgatcgatgccggc
cggcgcttcgtgctgtcggatcatcccgagcacgatcgcgatccggcagaccagcgcgag
ttcgcagcgatcggtgtcgagtggtggatcgagaacaacttgcccgtcgcgagcagcagc
gcggactttccgtacagcctgcgcgaagcgttgacgcaagcgcaggagggctacggtgcc
gatcccgcgtttcgcgtgccgcatgacgatggctcggtcggtttctacctcgtcgaagtc
gaagcgcagcgtgtgagcgtgccgtatcgcagcccgttcgagcacgagaagccgaagatg
catctcgagacggcgatcgtcgtcgggccgcagggcgaggaagtctataccgacgcgttg
aaccggatccgcgtgcagttcgtgtgggaccgtctgaacccgggcaacgagaacgcgtcg
tgctgggtgcgcgtggtgcagtcggataccggtggcggctacggcggcgtgcatgtgccg
cgcatcggcgaggaagtgctgatcgactatgtcggtggcgattgcgaccggccgcttgcg
gtcgggcgcgtgtacaacggcgcgaaccagccgcagtggcactccgacgggattctgtcc
ggataccggtcgaaagagtattcgggcggcggctacaaccagctcgtgatggacgacgcg
accgggcagaaccgcgtgcaactgatgagcagcagcgcgaacagcctgctgcatctgggc
tacatcatcgaccagaacggcaattcgcgcggctcgtatctgggcagcgggttcgacctg
cgctcggatgcgtatggcgcggtgcgggcgagccagggcctgtacgtcaccacccatccg
aaggcgccaaacagccagccgctcgacgtgaaggaagcgcagcagcagctcgtgacgggc
gagagcctggtcgaggcgatgtcgggcgtgagcgagcagcatcaggcggagagcctgaag
gacgcgcaagacacgatgcgcgcgttcaccgacgcaacgcagaacaacgtatcgggcaac
acgtccggcgggcgaacggcagacggcggcacgggcagcgcgaacgcattcaaggagccg
gtgatgctgttcggcagcccgtcagggatcgggatgtcgacgcagcagtcgctgcacatg
gtcgcgaacgatcacgtgaacgtcgcgagcggacagagcgtacatgtcgcggcgggcaag
tcgctgatcggcagcatcgggcagaagctgagcctgttcgtgcagaacgcggggatgaag
ctgttcgcgggcaagggcaaagtcgagatccaggcgcagtcggacaacgtcgaggtgacc
gcgcagaaggctgtgaaggttgtgtccgcaaccgaccgcatcgagatcgcggccgatcaa
gggattctgttgaccagcggcggcgggtatatccgcatccagggcggcaacatcgagatt
catacgccgggcgcggtggacgtgaagggcgcgtcgcatacgttcgcggggccggcgagc
atgggttatccgttgccgagcccgcggccggatcagccggggcagctcgagctgtttcac
aagtacgtgaacggcgaggccgtgaagggtgggttgttcacggtgaaagacgtgaacggc
gccgtgctgaagaagggcgcgctcgacaacagcggctatacggtggtgagcggcttgccg
cccggcgcggtacgcgtcgagttcggaaaggacccgcgcgagtcggaccagccggcgaat
tacttcaagcaggcgaagtggccggcagagccggtcgaaccgtcgccggaagccgcgcag
gcagcggcgagcggtcagctcgcgagccagttgcagggaatggcgcccgcggcgaccacg
gcggcgatggggctcgtgagtggcggcagcgcgggcgctgcgctcggcgggctcgcgagt
tccgcattgccggctgccgcgagtgcgctcggtggagcgggcgccgcgtcggcgttgcag
acggcttccagcctgagcggtgcagcgaagcaggtggccgggatggtgcaggccgcacgt
cagggtgggcttgcggcgctggccgcgccggccgcgaatgccgcgtccggagcgctgcag
ggagcgttgcccggcgtcgctggaatcgcgggcaagggcgccacgacggtggcgtcagcg
gcgggcggcatgaagctgccgacccccgggtttggcggaccgctgaaatcctga

DBGET integrated database retrieval system