KEGG   Burkholderia ambifaria MC40-6: BamMC406_0406
Entry
BamMC406_0406     CDS       T00684                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
bac  Burkholderia ambifaria MC40-6
Brite
KEGG Orthology (KO) [BR:bac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bac02044]
    BamMC406_0406
Secretion system [BR:bac02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BamMC406_0406
SSDB
Motif
Pfam: T6SS_TssF SOR_SNZ
Other DBs
NCBI-ProteinID: ACB62903
UniProt: B1YSA1
Position
1:453673..455508
AA seq 611 aa
MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARIN
KKLDDDYPEFTEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTEPVVIDRGTELKSRPIR
GVQCRFRTAYDVTLAPIRISEARYMPVALAPSATVLPSNATGVISITFESLAAQLDLGAL
KLPTLRAHLHGEQSFVAALTDCLFVNVLGAYVEPERNGRWTALRKLPIAHAGFDEDDALI
DYPAKSHPAYRLLTEYFAFPDKFDFVDFDVAAIARAAGRCQRATLHLVLQDVRSDSHVAR
LLELLTASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYEVYSIDSVKLV
RQQAHEESVIEFRPFYSLHHGESARIGHYWFARRNDWVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPSMLAFGLEGGDLFQEGGAQTSGISLLRRPTQSVRFERGRAAH
WRLVSHLALNHVSLVAHGLAPLKEMLTLYDLRRTAVSMRQIDGLVGVEQRGAVQWLPGKP
FATFVRGIEIRLTIDEEHFVGASLASFVRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIR
CKPRTGESILA
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggaagaattgctgccgtattacgagcgcgaattatcgtttttgcggcgctattcgcga
gatttcgccgaacgctatccgaagatcgccgcgcggctcgcgttgtccggcgagcactgc
gaggatccgcacgtcgagcggatgatcgagtcgttcgcgctgctgggcgcgcgcatcaac
aagaagctcgacgacgactacccggaattcaccgaagcgctgctggaagtgctgtatccg
cactacctgcggccgttcccgtcgtgctcgatcgcgcaattcacgccggcttcgcccggc
cagcagaccgaaccggtcgtgatcgaccgcggcaccgagctgaagagccgtccgatccgc
ggcgtgcagtgccggttccgcaccgcgtacgacgtgacgctcgcgccgatccgcatttcg
gaggcgcgctacatgccggtcgcgctcgcgccgagcgcgacggtgctgccgtccaacgcg
acgggcgtgatctcgatcacgttcgaatcgcttgccgcgcagctcgatctcggcgcgctg
aagctgccgacgctgcgcgcgcacctgcacggcgaacagtcgttcgtcgccgcgctgacc
gactgcctgttcgtcaacgtgctcggcgcgtatgtcgagcccgagcgcaacggccgctgg
accgcgctgcgcaagctgccgatcgcgcacgccggcttcgacgaggacgacgcgctgatc
gactacccggcgaagtcgcaccccgcctatcgcctgctcaccgaatacttcgcattcccc
gacaagttcgatttcgtcgatttcgacgtcgcggcgatcgcgcgcgcggcgggccgctgc
cagcgcgcgacgctgcatctggtgctgcaggacgtgcgcagcgattcgcacgtcgcgcgg
ctgctcgagctgctgacggccagccatttccggctgttctgcacgccgatcgtcaacctg
ttccgccagcacggcgagccgatccgcatcacgcaccgcgctgtgtcgtacccggtgatc
gccgaagcgcgccgggcgttcgcgtacgaggtgtattcgatcgattcggtgaagctcgtc
cggcagcaggcgcacgaggaatcggtgatcgagttccggccgttctattcgctgcatcac
ggcgaatcggcgcggatcggtcattactggttcgcgcgccgcaacgactgggtcgcgcag
aaaagccccggatacgaaacggagatctcgatcgtcgacatcgacttcgagccgacgtcg
ccgcagaccgacacgctgagcctcgacctcacctgcacgaaccgcgatctgccgtcgatg
ctcgcgttcggcctcgaaggcggcgacctgttccaggaaggcggcgcgcagacgagcggc
atctcgctgctgcggcgcccgacccagagcgtgcgtttcgagcgcggccgcgccgcgcac
tggcggctcgtgtcgcacctcgcgctgaaccacgtgtcgctggtcgcgcacgggctcgcg
ccgctcaaggaaatgctgacgctgtacgacctgcggcgcaccgccgtgtcgatgcgccag
atcgacggcctcgtcggcgtcgagcagcgcggcgccgtgcagtggctgcccggcaagccg
ttcgcgaccttcgtgcgcggcatcgagatccggctgacgatcgacgaggagcacttcgtc
ggcgcgagcctcgcgtcgttcgtgcgcgtgctcgacagcttcttcgggctgtatgtccac
ctcaacagtttcgttcaactagtcgtggtgtcgaagcgcaccggcgaggagatcatccga
tgcaagccccgaaccggcgaatcgatcctggcgtag

DBGET integrated database retrieval system