KEGG   Burkholderia ambifaria MC40-6: BamMC406_0407Help
Entry
BamMC406_0407     CDS       T00684                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
bac  Burkholderia ambifaria MC40-6
Brite
KEGG Orthology (KO) [BR:bac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bac02044]
    BamMC406_0407
Secretion system [BR:bac02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BamMC406_0407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: ACB62904
UniProt: B1YSA2
Position
1:455472..456572
Genome map
AA seq 366 aa AA seqDB search
MQAPNRRIDPGVVDALLDEPHRFEFFQAVRVLEGLFARQASDAPGAWRQGDVVAQHIEFR
NTLSLGFPPSEIEGARSFHDGGALLDSGDERDAALAAGELGHVELTPAFFGLLGAQGALP
LHYTEQIVAREHLKRDHAARAFFDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLL
AIAGVPSDEIRDNLAAGAGGVLDEAVAGYALAARHRPMSAAYLQRALSDYFRVPVKIDQF
VGKWYDVPPDQLSVLGEVNVVLGATALVGERVWQRDMRARIVVGPLSKRDYEAFLPGGAH
AVALERMLTLLAGVTLEYEVKLVLKRTEVGASVLGAGSRLGWDAFLCTRDALHDRSDARY
ELHVIH
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccccgaaccggcgaatcgatcctggcgtagtcgacgcgctgctcgacgagccg
caccgcttcgaattcttccaggcggtgcgcgtgctcgaagggctgttcgcacggcaggcg
tccgatgcgcccggcgcatggcggcagggcgacgtcgtcgcgcagcacatcgaattccgc
aacacgctgtcgctcggctttccgccgagcgagatcgaaggcgcgcgctcgttccacgac
ggcggcgcgctgctcgattcgggggatgaacgcgacgccgcgctcgcggccggcgagctc
ggtcacgtcgagctgacgccggcgttcttcggactgctcggcgctcagggcgcgctgccg
ctgcactacaccgagcagatcgtcgcgcgcgagcacctgaagcgcgaccacgcggcgcgc
gcgttcttcgacgtgttctcgaaccgcgcgaccgcgctgttctatgcggcgtggaagaaa
taccggctgccgttccattacgaactcgatcgcgacgagcgctacctgccgctcttgctc
gcgatcgccggcgtgccgagcgacgagatccgcgacaacctcgcggccggcgcgggaggc
gtgctcgacgaggccgtcgccggctacgcgctcgccgcgcggcaccggccgatgtcggcc
gcgtacctgcagcgcgcgctgtccgactacttccgcgtgccggtgaagatcgatcagttc
gtcggcaaatggtacgacgtgccgcccgaccagttgagcgtgctcggcgaggtcaacgtg
gtgctcggcgcgacggcgctcgtcggcgaacgtgtgtggcagcgcgacatgcgcgcgcgg
atcgtcgtcggcccgctgtccaagcgcgactacgaggcgttcctgcccggcggcgcgcac
gccgtcgcgctcgaacggatgctgacgctgctcgccggcgtcacgctcgaatacgaggtg
aagctcgtgctgaagcgcaccgaggtgggcgcgagcgtgctcggcgcaggctcgcggctc
ggctgggacgcgttcctctgcacgcgcgacgcgctccacgaccgctcggacgcccgctac
gaactgcacgtgattcactga

DBGET integrated database retrieval system