KEGG   Burkholderia ambifaria MC40-6: BamMC406_0466Help
Entry
BamMC406_0466     CDS       T00684                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
bac  Burkholderia ambifaria MC40-6
Brite
KEGG Orthology (KO) [BR:bac00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BamMC406_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: ACB62963
UniProt: B1YSG1
Position
1:522587..523030
Genome map
AA seq 147 aa AA seqDB search
MPNQCGAAWPLESARALTYSGNIMSQYQFTVSVKTSYLPEQSDPDRRQYAFAYTLTIRNT
GQVAAQLIARHWIITDSENHVQEVKGLGVVGHQPLLQPGEHFEYTSWAVIATPVGTMRGA
YFCVAEDGERFEAPVEEFALHMPRTLH
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaccaatgcggcgcggcctggccgctcgaatcggcgcgggcgcttacctacagc
ggaaacatcatgagtcagtatcagttcaccgtttcggtgaaaaccagctacttgccggaa
caatccgaccccgatcgacgtcaatacgcattcgcgtacacgctgaccatccgcaatacc
ggacaggtcgcggcgcagctgatcgcgcgtcactggatcatcacggacagcgaaaaccac
gtgcaggaagtgaaggggctcggcgtcgtcgggcaccagccgctgctgcagccgggcgaa
cacttcgaatacacgagctgggccgtgatcgcgacgccggtcggcacgatgcgcggcgcg
tacttctgcgtggcggaggacggcgagcggttcgaggcgccggtcgaggaatttgcgctg
cacatgccgcgcacgctgcattga

DBGET integrated database retrieval system