KEGG   Burkholderia ambifaria MC40-6: BamMC406_0827Help
Entry
BamMC406_0827     CDS       T00684                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00740  Riboflavin metabolism
bac00790  Folate biosynthesis
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
Module
bac_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BamMC406_0827
   00790 Folate biosynthesis
    BamMC406_0827
Enzymes [BR:bac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BamMC406_0827
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     BamMC406_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ACB63320
UniProt: B1YUJ3
Position
1:complement(915409..916551)
Genome map
AA seq 380 aa AA seqDB search
MTLASTLDIIAELKAGRMVILVDEEDRENEGDLVIAAEFVTPEAINFMAKYGRGLICLTL
TQERCKQLHLPLMTYRNGTQYGTAFTVSIEAAEGVTTGISAADRAHTIATAVAHDVRPEH
IVQPGHVFPIMAQPGGVLVRAGHTEAGCDFTALAGLTPAAVICEVIKDDGTMARLPDLLE
FAKEHNLKIGTIADLIHYRSRTESIIERIAERTMQTAHGTFRAVLYRDQPTGSPHIALVR
GTPSPDVDTPVRVHEPLSVLDLLETSISTHSWTLDAAMRDIAERDLGVIVLLNCGDTKEH
LIDVFKAFDEEEKAAALKRRPVDFKTFGIGAQILRDVGVGKMQVLSNPRKLGSMSGYGLE
VTGFIPMPGGEAKSCPASHA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgcctccacgctcgacatcatcgcggagttgaaagccggccggatggtgatc
ctggtcgacgaagaagaccgcgaaaacgaaggcgacctcgtgatcgccgccgaattcgtc
acgccggaagcgatcaacttcatggccaagtacggccgcggcctgatttgtctgacgttg
acgcaggaacgctgcaagcagctgcacctgccgctgatgacctaccgcaacggcacccag
tacggcaccgcgttcacggtcagcatcgaagcggccgaaggcgtgacgaccggcatctcg
gccgccgatcgcgcgcacacgatcgccacggcggtcgcgcacgacgtgcgccccgagcac
atcgtgcagccgggccacgtgttcccgatcatggcgcagccgggcggcgtgctggtgcgt
gccggccacaccgaggccggctgcgacttcaccgcgcttgccgggctcacgccggccgcg
gtgatctgcgaggtcatcaaggacgacggcacgatggcgcgtctgcccgacctgctcgag
ttcgcgaaggagcacaacctgaagatcggcacgatcgccgacctgatccactaccgcagc
cgcaccgaatcgatcatcgagcggatcgccgagcgcacgatgcagaccgcgcacggcacg
ttccgcgcggtgctgtaccgcgaccagccgaccggctcgccgcacatcgcgctggtgcgc
ggcacgccgtcgcccgacgtcgatacgcccgtgcgcgtgcacgagccgctgtcggtcctc
gacctgctcgagacgagcatctcgacgcactcgtggacgctcgacgccgcgatgcgcgac
atcgcggaacgcgacctcggcgtgatcgtgctgctcaactgcggcgacacgaaggaacat
ctgatcgacgtcttcaaggcgttcgacgaggaagaaaaggccgctgcgctgaagcgccgg
ccggtcgatttcaagacgttcggcatcggcgcgcagatcctgcgcgacgtcggcgtcggc
aagatgcaggtgctgtcgaatccgcgcaagctgggcagcatgtccggctacggcctcgaa
gtcacgggcttcattccgatgcccggcggcgaagccaagtcctgcccggcgtcccacgcg
taa

DBGET integrated database retrieval system