KEGG   Burkholderia ambifaria MC40-6: BamMC406_0980Help
Entry
BamMC406_0980     CDS       T00684                                 

Definition
(GenBank) nicotinate phosphoribosyltransferase
  KO
K00763  nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00760  Nicotinate and nicotinamide metabolism
bac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BamMC406_0980
Enzymes [BR:bac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     BamMC406_0980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAPRTase NAPRTase_N
Motif
Other DBs
NCBI-ProteinID: ACB63471
UniProt: B1YVJ0
Position
1:1069616..1070815
Genome map
AA seq 399 aa AA seqDB search
MIITSLLDTDLYKFTMMQVVLHHFPAANVEYRFRCRTPGVDLVPYIDEIRDEVRGLCSLR
FTDIELDYLRRMRFIKSDFVDFLALFHLNEKYISITPSPKGNGEIDIVIEGPWLHTILFE
IPVLAIVNEVYFRNTQREPDYREGRERLREKIKLLGAKPEFADCKIADYGTRRRFSKVWH
EEVALTLRDGLGPQFAGTSNVFYAMKHELTPLGTMAHEYLQACQALGPRLRDSQTYGFEM
WAKEYRGDLGIALSDVYGMDAFLNDFDMYFCKLFDGARHDSGDPFEWGERMLRHYEANRC
DPRTKVLVFSDALDIPKVMQLYERFRNRCKLAFGVGTNLTNDLGYVPLQIVIKMVRCNGQ
PVAKLSDSPGKSMCDDRAYLAYLRQVFGIAQPVDDDASQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcacttcgctgctcgacacggatctctacaagttcacgatgatgcaggtcgtc
ctgcatcactttcccgccgcaaatgtcgagtaccggttccggtgccgcacgcccggcgtc
gatctcgttccgtacatcgacgagatccgcgacgaggtgcgcggcctctgttcgctgcgc
ttcaccgacatcgaactcgactacctgcggcggatgcgcttcatcaagagcgatttcgtc
gacttcctcgcgctgttccatttgaacgagaagtacatctcgatcacgccttcgccgaag
ggcaacggcgagatcgacatcgtgatcgaggggccgtggctgcacacgatcctgttcgag
atcccggtgctcgcgatcgtcaacgaagtctatttccgcaacacgcagcgcgagcccgac
tatcgcgaaggccgcgagcggctgcgcgagaagatcaagctgctcggcgcgaagcccgag
ttcgccgactgcaagatcgccgactacggcacgcgccgacgcttctcgaaggtgtggcac
gaggaggtcgcgctgacgctgcgcgacgggctcgggccgcagttcgcgggcacgagcaac
gtgttctacgcgatgaagcacgagctgacgccgctcggcacgatggcgcacgaatacctg
caggcatgccaggcgctcggcccgcggctgcgcgattcgcagacttacggtttcgagatg
tgggcgaaggagtatcgcggcgacctcgggatcgcgctgtcggacgtctacggaatggat
gcgttcctgaacgacttcgacatgtacttctgcaagctgttcgacggcgcgcgccacgat
tcgggcgatccgttcgagtggggcgagcgcatgctgcgccactacgaggcgaaccgctgc
gacccgcgcaccaaggtgctcgtgttctcggatgcgctcgacatcccgaaggtcatgcag
ctgtacgaacggttccgcaaccgctgcaagctcgcgttcggcgtcggcaccaatctcacg
aacgatctcggctacgtgccgctgcagatcgtgatcaagatggtccgctgcaacggccag
ccggtcgcgaagctgtcggattcgccgggcaagagcatgtgcgacgaccgcgcgtatctc
gcgtacctgcgccaggtgttcggcatcgcgcagccggtcgacgacgacgcatcgcagtag

DBGET integrated database retrieval system