KEGG   Burkholderia ambifaria MC40-6: BamMC406_1343
Entry
BamMC406_1343     CDS       T00684                                 

Definition
(GenBank) periplasmic binding protein/LacI transcriptional regulator
  KO
K17213  inositol transport system substrate-binding protein
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BamMC406_1343
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bac02000]
    BamMC406_1343
Transporters [BR:bac02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Inositol transporter
    BamMC406_1343
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 Peripla_BP_6
Other DBs
NCBI-ProteinID: ACB63831
UniProt: B1YNL3
Position
1:1489396..1490322
AA seq 308 aa
MKTKLMAAAAAAILTMPLAHAEKIGVTMASFDDTFLTILRNSIGDAAKKDGATVQIEDGG
NDVGKQLSQVQNMIAQKVDAIIVNAVDTDATPKITKMVSAAKIPLVYVNRKPVDFDKLPA
GVAVVASDEKQSGTLQARQVCKLLGGKGDILVLMGELSNESARARTKDIEDVIATKDCSG
MKIVDKREGKWSRTQGQDITMNWLSSGTKFDAIVSNNDEMAIGAINALKAARKLTPKTVV
AGIDATPDGLAAMKSGELKVSVYQNAAGQGAQAVATALKLARKQPVERYVNVPFELVTPE
NMNQYAKH
NT seq 927 nt   +upstreamnt  +downstreamnt
atgaagaccaagctgatggccgccgcggccgccgcgatcctgaccatgccgctcgcgcac
gccgagaagatcggcgtgacgatggcatcgttcgacgacacgttcctgacgatcctgcgc
aacagcatcggcgacgcggcgaagaaggacggcgcgaccgtgcagatcgaggatggcggc
aacgacgtcggcaagcagttgagccaggtccagaacatgatcgcgcagaaggtcgacgcg
atcatcgtgaacgcggtcgacaccgacgcgacgccgaagatcacgaagatggtgagcgcc
gcgaagattccgctcgtctacgtgaaccgcaagccggtcgacttcgacaagctgccggcc
ggcgtcgcggtggtcgcgtccgacgagaagcagtcgggcacgctgcaggcccgccaggtg
tgcaagctgctcggtggcaagggcgacatcctcgtgctgatgggcgagttgtccaacgag
tcggcacgtgcgcgcaccaaggacatcgaggacgtgatcgcgaccaaggactgttccggc
atgaagatcgtcgacaagcgcgaaggcaagtggagccgcacgcagggccaggacatcacg
atgaactggctgagttccggcacgaagttcgacgcgatcgtgtcgaacaacgacgaaatg
gcgatcggcgcgatcaatgcgctgaaggccgcgcgcaagctgacgccgaagacggtcgtc
gcgggcatcgacgcgacgccggacgggctcgcggcgatgaagagcggcgagctgaaggtg
tccgtgtaccagaacgcggcagggcagggcgcgcaggccgtcgcgaccgcgctgaagctt
gcgaggaagcagccggtcgagcgctacgtgaacgtgccgttcgagctcgtcacgccggag
aacatgaaccagtacgcgaagcactga

DBGET integrated database retrieval system