KEGG   Burkholderia ambifaria MC40-6: BamMC406_1748Help
Entry
BamMC406_1748     CDS       T00684                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00010  Glycolysis / Gluconeogenesis
bac00020  Citrate cycle (TCA cycle)
bac00620  Pyruvate metabolism
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
bac01120  Microbial metabolism in diverse environments
bac01130  Biosynthesis of antibiotics
bac01200  Carbon metabolism
Module
bac_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BamMC406_1748
   00020 Citrate cycle (TCA cycle)
    BamMC406_1748
   00620 Pyruvate metabolism
    BamMC406_1748
Enzymes [BR:bac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BamMC406_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Biotin_lipoyl Hydrolase_4 Thioesterase Ndr Esterase Abhydrolase_5 PGAP1 Ser_hydrolase Abhydrolase_8 DUF900 DUF676 Lipase_3 DUF2974
Motif
Other DBs
NCBI-ProteinID: ACB64233
UniProt: B1YRF9
Position
1:complement(1953333..1954448)
Genome map
AA seq 371 aa AA seqDB search
MSIHMITMPKWGLSMEQGQVNGWLKAIGERVSKGDEVLDVETDKISSGVECAFDGTLRRQ
VAQEGETLPVGALLGVVAAADASDADIDAAIAEFQRDFTPSAAADDAGGPQPEKAQIGGR
TIRFLKLGDGTGTPAVLIHGFGGDLNNWLFNHAELAAHRPVWALDLPGHGESAKAVDTGS
LDELADAVLALLDAQHIGRAHLIGHSMGGAVAMAAAERAPQRVASLTLIASAGLGADINR
GYIDGFVAGNSRNTLKPHLGALFADHALVTRQLVEDLVKYKRLEGVQAALEKIANAAFDG
AAQRRVFRDRVASLAPRTLVIWGERDEVIPAQHAQGLPDGVQAEVIAGSGHMVQMEAAAD
VNRLIVAFLGD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcacatgatcacgatgcccaagtgggggctgtcgatggagcaggggcaggtc
aacggctggctgaaggcaatcggcgagcgcgtctcgaagggcgacgaagtgctcgacgtc
gagaccgacaagatctcgtcgggcgtcgagtgcgcgttcgacggcacgctgcgccggcag
gtcgcgcaggagggcgagacgctgccggtcggtgcgctgctcggcgtggtggcggcggcc
gacgcgagcgatgccgacatcgatgcggcgattgccgaattccagcgcgatttcacgccg
agcgcggccgcggacgacgccggcggcccgcagcccgagaaggcgcagatcggcggacgc
acgatccggttcctgaagctcggagacggaacgggcacgcccgcggtgctgatccacggc
ttcggcggcgacctgaacaactggctgttcaaccatgcggaactcgccgcgcaccggccc
gtgtgggcgctcgatctgcccgggcacggcgagtcggccaaggcggtcgacaccggcagc
ctcgacgaactggccgacgcggtgctcgcgctgctcgacgcgcagcatatcggccgcgcg
cacctgatcggccattcgatgggcggcgcggtcgcgatggcggcggccgagcgcgcgccg
caacgcgtggcgtcgctgacgctgatcgcgagcgccgggctcggcgccgacatcaaccgc
ggctacatcgacggcttcgtcgccggcaacagccgcaatacgctgaagccgcacctcggc
gcgctgttcgcggaccacgcgctcgtcacgcggcaactggtcgaggatctcgtcaagtac
aagcgactcgaaggcgtgcaggccgcgctggagaagatcgcgaacgcagcgttcgacggc
gcggcccagcggcgcgtgttccgcgaccgcgtcgcgtcgctcgcgccgcgcacgctcgtg
atctggggcgagcgcgacgaggtgattcccgcgcagcatgcgcagggcttgccggacggc
gtgcaggccgaggtaatcgccggcagcggccacatggtgcagatggaggcggctgccgac
gtgaaccgcctgatcgtcgcgtttctcggagactga

DBGET integrated database retrieval system