KEGG   Burkholderia ambifaria MC40-6: BamMC406_1822Help
Entry
BamMC406_1822     CDS       T00684                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00071  Fatty acid degradation
bac00072  Synthesis and degradation of ketone bodies
bac00280  Valine, leucine and isoleucine degradation
bac00310  Lysine degradation
bac00362  Benzoate degradation
bac00380  Tryptophan metabolism
bac00620  Pyruvate metabolism
bac00630  Glyoxylate and dicarboxylate metabolism
bac00640  Propanoate metabolism
bac00650  Butanoate metabolism
bac00900  Terpenoid backbone biosynthesis
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
bac01120  Microbial metabolism in diverse environments
bac01130  Biosynthesis of antibiotics
bac01200  Carbon metabolism
bac01212  Fatty acid metabolism
bac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BamMC406_1822
   00630 Glyoxylate and dicarboxylate metabolism
    BamMC406_1822
   00640 Propanoate metabolism
    BamMC406_1822
   00650 Butanoate metabolism
    BamMC406_1822
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BamMC406_1822
   00072 Synthesis and degradation of ketone bodies
    BamMC406_1822
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BamMC406_1822
   00310 Lysine degradation
    BamMC406_1822
   00380 Tryptophan metabolism
    BamMC406_1822
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BamMC406_1822
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BamMC406_1822
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BamMC406_1822
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bac04147]
    BamMC406_1822
Enzymes [BR:bac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BamMC406_1822
Exosome [BR:bac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BamMC406_1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACB64305
UniProt: B1YRN1
Position
1:complement(2026536..2027714)
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTPLAKSWRGAFNMTHGATLGGHVVAAALERAKLDPARIEDVIMGCANPE
GATGANIARQIALRAGLPVSVPGMTVNRFCSSGLQTIALAAQRIIAGEGDVYIAGGVESI
SCVQNEMNRHMLQEGWLVEHKPEIYWNMLQTAENVAKRYGISKERQDAYGVQSQLRAAAA
QEAGRFDDEIVPITVRAGIADKATGRLFTQDVTVSADEGIRPDTTLEGVSKIRSAVPGGV
ITAGNASQFSDGASACVVMNADVAQRKGLRPLGVFRGFAVAGCEPDEMGIGPVFAVPKLL
KQAGLKVDDIGLWELNEAFAVQVLYCRDTLGIPEDRLNVNGGAIAVGHPYGVSGARLTGH
ALIEGKRRGVKYVVVTMCIGGGQGAAGLFEIV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtaatcgtatcgaccgcacgcacgccgctcgcgaaatcgtggcgcggc
gcattcaacatgacgcacggcgcgacgctcggcggccacgtggtcgctgccgcgctcgaa
cgcgcgaagctcgaccccgcgcgcatcgaggacgtgatcatggggtgcgcgaaccctgaa
ggcgcgaccggcgccaacatcgcgcggcagatcgcgctgcgcgccgggctgccggtgagc
gtgccggggatgacggtgaaccgtttctgctcgtccggtcttcagacgatcgcgctcgcc
gcgcagcggatcatcgcgggcgagggcgacgtgtacatcgccggcggcgtcgaatcgatc
tcgtgcgtgcagaacgagatgaaccggcacatgcttcaggaaggctggctcgtcgagcac
aagcccgagatctactggaacatgctgcagacggcggagaacgtcgcgaagcgctacggg
atttcgaaggagcggcaggacgcgtacggcgtgcagtcgcaactgcgggccgcggccgcg
caggaagccggtcgcttcgacgacgagatcgtgccgatcaccgtacgcgcgggcattgcc
gacaaggcgacgggccggctgttcacgcaggacgtgacggtgtcggccgacgaaggcatc
cggcccgacacgacgctcgaaggcgtgtcgaagatccgttcggccgtgccgggcggcgtg
atcaccgcgggcaacgcgagccagttctcggacggcgcgtcggcgtgcgtggtgatgaac
gcggatgtcgcgcagcgcaaagggctgcgtccgctcggcgtgttccgcggtttcgcggtg
gccggttgcgagccggacgagatgggcatcggcccggtgttcgcggtgccgaagctgctg
aagcaggccgggctgaaggtcgacgacatcggcctgtgggaactgaacgaagcgttcgcg
gtgcaggtgctgtactgtcgcgacacgctcgggattcctgaggaccgcctgaacgtgaac
gggggcgcgatcgcggtcggccatccgtacggcgtgtcgggtgcgcgcctgaccggtcat
gcgctgatcgaaggcaagcggcgtggcgtgaaatacgtggtcgtcacgatgtgcatcggc
ggcggccagggagcggccgggctgttcgaaatcgtttga

DBGET integrated database retrieval system