KEGG   Burkholderia ambifaria MC40-6: BamMC406_1953Help
Entry
BamMC406_1953     CDS       T00684                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00361  Chlorocyclohexane and chlorobenzene degradation
bac00625  Chloroalkane and chloroalkene degradation
bac01100  Metabolic pathways
bac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BamMC406_1953
   00361 Chlorocyclohexane and chlorobenzene degradation
    BamMC406_1953
Enzymes [BR:bac01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BamMC406_1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ACB64435
UniProt: B1YSJ9
Position
1:2175470..2176231
Genome map
AA seq 253 aa AA seqDB search
MSATTTLSSPDAILFDAFGTLFDVHAVVAAAEQMFPGHGERLSQLWRRKQIEYSQLRTLA
DPAGARYRPFRDITLDALRFAARVLGLTLNSAAEKRLMDEYACLSTYPDTLPALRKLRAL
DPRPPLAILSNGNPEMLDIAIKSAGMTGLFDRVLSADTVRAYKPSPAVYALGTAAFGANA
RDIVFVSSNAWDVAGAAWFGYTTFWLNRTGAPAEELGAPPDGTGSGMADLLAFLATPAPS
GRPANRARPGPGA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccacaacgacactctcctctcccgacgcaatcctcttcgacgcattcggcacg
ttgttcgacgtgcatgcggtcgtggccgcggcggagcagatgtttcccggtcacggggag
cggttgtcgcagctgtggcgacgcaagcaaatcgaatactcgcagttgcgcacgctcgcc
gatccggccggcgcccgctatcgcccgtttcgcgacatcacgctcgacgcgctgcgcttc
gccgcgcgcgtgctcggcctcacgctgaacagcgcggccgagaaacggctgatggacgaa
tacgcgtgcctgtccacctaccccgacacgctgcccgcgctgcgcaagctgcgcgcgctc
gacccgcgcccgccgctcgcgatcctgtcgaacggcaacccggagatgctcgacatcgcg
atcaagagcgccggcatgaccggcctgttcgatcgcgtgctgtcggccgacacggtgcgc
gcgtacaagccgagtccggccgtctacgcactcggcaccgcggcgttcggcgcgaacgcg
cgcgacatcgtgttcgtgtcgtcgaacgcgtgggacgtcgcgggggccgcctggttcggc
tacacgacgttctggctcaaccgcacgggcgcgcccgccgaggaactcggcgcgccgccc
gatggcaccggcagcggcatggccgatctgctcgccttcctcgccaccccggctccgtcc
ggcagacccgcaaaccgcgcgcgccccggcccgggcgcatga

DBGET integrated database retrieval system