KEGG   Burkholderia ambifaria MC40-6: BamMC406_2350Help
Entry
BamMC406_2350     CDS       T00684                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00450  Selenocompound metabolism
bac00970  Aminoacyl-tRNA biosynthesis
bac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BamMC406_2350
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BamMC406_2350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bac01007]
    BamMC406_2350
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bac03016]
    BamMC406_2350
Enzymes [BR:bac01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BamMC406_2350
Amino acid related enzymes [BR:bac01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BamMC406_2350
Transfer RNA biogenesis [BR:bac03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BamMC406_2350
 Prokaryotic type
   Other AARSs
    BamMC406_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ACB64828
UniProt: B1YUT2
Position
1:2618341..2620503
Genome map
AA seq 720 aa AA seqDB search
MSASDLTSVQATAPQGRRQILVTSALPYANGQIHIGHLVEYIQTDIWVRTLRMHGHEVYY
IGADDTHGTPVMLRAEKEGLTPKQLIDRVWTEHKRDFDSFGVSFDNFYSTDSDENRVLSE
SIYLALKENGLIAERAIEQAYDPVKEMFLPDRFIKGECPKCHAKDQYGDNCEVCGSTYLP
TELLNPYSVVSGATPVRKTSTHYFFRLSDPRCESFLREWVSGLAQPEATNKMREWLGDAG
EAKLADWDISRDAPYFGFEIPGAPGKYFYVWLDAPVGYYASFKNLCDREGIDFDAWIRAG
STAEQYHFIGKDILYFHTLFWPAMLEFSGHRTPTNVFAHGFLTVDGAKMSKSRGTFITAQ
SYIDTGLNPEWLRYYFAAKLNATMEDIDLNLDDFQARVNSDLVGKYVNIASRAAGFLIKR
FDGRVQDSAMNHPLVAKLRDAIASIAAHYEGREYSRALRQTMELADEVNAYVDGAKPWEL
AKDPANAVALHETCSVSLEAFRLLSLALKPVMPRVAEAVEAFFGVAPLAWADAAKPLSSA
QPIKAYQHLMTRVDPKQIDALLAANRDSLQADAAGAAAAGTTAANAAKDAKSAKANAKAV
AANGADDAPISIDDFAKVDLRIAKIVACQAVEGSDKLLQLTLDIGEEKTRNVFSGIKSAY
QPEQLVGKLTVMVANLAPRKMKFGLSEGMVLAASAADEKAEPGLYILEPHSGAKPGMRVK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatccgacctgacttccgtgcaggctacggcgccgcaaggccgccgccagatc
ctcgttacgtccgcactgccctatgccaacggccagatccatatcggccacctggtcgag
tacatccagaccgacatctgggtgcggacgctgcgaatgcacggccacgaggtctactac
atcggcgccgacgacacgcacggcacgccggtcatgctgcgcgccgagaaggaaggcctc
acgccgaagcagctgatcgaccgcgtgtggaccgagcacaagcgcgacttcgacagcttc
ggcgtgtcgttcgacaacttctactcgaccgattcggacgagaaccgcgtgctgagcgag
agcatctatctcgcgctgaaggaaaacggcctgatcgccgagcgcgcgatcgagcaggcg
tacgacccggtcaaggaaatgttcctgccggaccgcttcatcaagggcgagtgcccgaag
tgccacgcgaaggaccagtacggcgacaactgcgaagtgtgcggctcgacctacctgccg
accgaactgctgaacccgtattcggtggtgtcgggtgcgacgccggtgcgcaagacgtcg
acgcactacttcttccgcctgtccgacccgcgctgcgagtcgttcctgcgcgaatgggtc
agcggcctcgcgcagcccgaagccaccaacaagatgcgcgaatggctcggcgacgccggt
gaagccaagctcgccgactgggacatctcgcgcgacgcgccgtacttcggcttcgagatc
ccgggcgcgcccggcaagtacttctacgtgtggctcgacgcgccggtcggctactacgcg
agcttcaagaacctgtgcgaccgcgagggcatcgacttcgacgcgtggatccgcgcgggt
tcgacggccgagcagtatcacttcatcggcaaggacatcctgtatttccacacgctgttc
tggccggcgatgctcgaattctcgggccatcgcacgccgaccaacgtgttcgcgcacggc
ttcctgacggtcgacggcgcgaagatgtcgaagtcgcgcggcacgttcatcaccgcgcag
agctacatcgacaccggcctgaaccccgaatggctgcgctactacttcgccgcgaagctg
aacgcgacgatggaagacatcgacctgaacctcgacgacttccaggcgcgcgtgaacagc
gacctcgtcggcaagtacgtgaacatcgcgagccgcgcggccggcttcctgatcaagcgt
ttcgacggccgcgtgcaggacagcgcgatgaaccatccgctcgtcgcgaagctgcgcgat
gcgatcgcgtcgatcgccgcgcactacgaaggacgcgaatacagccgcgcgctgcgccag
acgatggagctcgcggacgaagtgaacgcgtacgtcgacggtgcgaagccgtgggaactc
gcgaaggatccggccaacgcggtcgcgctgcacgaaacctgcagcgtgagcctcgaggcg
ttccgcctgctgtcgctcgcgttgaagccggtgatgccgcgcgtggccgaagcggtcgag
gcgttcttcggcgtcgcgccgctcgcgtgggccgatgccgcgaagcccctgtcgtcggcg
cagccgatcaaggcgtaccagcacctgatgacgcgtgtcgatccgaagcagatcgacgcg
ctgctcgccgcgaaccgcgattcgctgcaggccgacgcggcgggcgccgctgccgcgggc
acgaccgccgccaacgccgcgaaggacgcgaagagcgccaaggcgaacgcgaaggcggtt
gccgcgaacggtgccgacgacgctccgatctcgatcgacgatttcgcgaaggtcgacctg
cgcatcgcgaagatcgtcgcgtgccaggccgtcgaaggctcggacaagctgctgcagctc
acgctcgacatcggcgaggaaaagacccgcaacgtgttctcgggcatcaagtcggcctac
cagccggagcagctcgtcggcaagctgacggtgatggtcgcgaacctcgcgccgcgcaag
atgaagttcgggctgtccgaagggatggtgctcgccgcatcggcggccgacgagaaggcg
gaaccgggcctctacatcctcgagccgcacagcggcgcgaagcccggcatgcgcgtgaag
taa

DBGET integrated database retrieval system