KEGG   Burkholderia ambifaria MC40-6: BamMC406_2774Help
Entry
BamMC406_2774     CDS       T00684                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00010  Glycolysis / Gluconeogenesis
bac00260  Glycine, serine and threonine metabolism
bac00680  Methane metabolism
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
bac01120  Microbial metabolism in diverse environments
bac01130  Biosynthesis of antibiotics
bac01200  Carbon metabolism
bac01230  Biosynthesis of amino acids
Module
bac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bac_M00002  Glycolysis, core module involving three-carbon compounds
bac_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BamMC406_2774
  Energy metabolism
   00680 Methane metabolism
    BamMC406_2774
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BamMC406_2774
Enzymes [BR:bac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BamMC406_2774
Membrane trafficking [BR:bac04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BamMC406_2774
Exosome [BR:bac04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BamMC406_2774
  Exosomal proteins of melanoma cells
   BamMC406_2774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACB65251
UniProt: B1YNA6
Position
1:3072831..3073577
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQAGELLREAGYTFDIAYTSVLKR
AIRTLWHVQDRMDLMYLPVVHSWRLNERHYGALSGLNKAETAAKFGDDQVLVWRRSYDTP
PPALEPTDERAPFNDPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVRSGKQVLIA
AHGNSLRALIKYLDGISDSDIVGLNIPNGVPLVYELDEDLKPLKHYYLGDQDAIAKAQAA
VAKQGKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgacgtcgacctgaccgaacagggtcgcaacgaggcctaccaggccggc
gaactgctcagggaggccggctacacgttcgacatcgcgtacacgtcggtgctcaagcgc
gcgatccgcacactgtggcacgtgcaggaccggatggacctgatgtacctgccggtcgtc
cactcgtggcgcctgaacgagcgccactacggcgcgctgtcgggcctgaacaaggcggaa
acggccgccaagttcggcgacgaccaggtgctcgtgtggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgaccgacgaacgcgcgccgttcaacgacccgcgctacgcgaag
gtgccccgcgagcagctgccgctcaccgagtgcctgaaggacacggtcgcgcgcgtgctg
ccgctgtggaacgaatcgatcgcgccggccgtccgctcgggcaagcaggtgctgatcgcc
gcgcacggcaactcgctgcgcgcgctgatcaagtacctcgacggcatttcggacagcgac
attgtcggcctgaacatcccgaacggcgtgccgctcgtgtatgagctcgacgaagacctg
aagccgctcaagcactactacctcggcgaccaggacgcgatcgcgaaggcgcaggccgcc
gtcgcgaagcagggcaaggcgggctga

DBGET integrated database retrieval system