KEGG   Burkholderia ambifaria MC40-6: BamMC406_3012
Entry
BamMC406_3012     CDS       T00684                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
bac  Burkholderia ambifaria MC40-6
Brite
KEGG Orthology (KO) [BR:bac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bac02044]
    BamMC406_3012
Secretion system [BR:bac02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BamMC406_3012
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACB65488
UniProt: B1YPS4
Position
1:3334586..3336466
AA seq 626 aa
MDPRFLDHYNRELTYMRELSAEFAAQHPKIARRLGMHGIETADPYVERMIEAFCFMSART
QLKLDAEFPRFTQRLLEVVYPNYVAPTPSMAVAKLRPSLREGNFSKGFTVPRHSVLRSSI
PPGERTACEFRSGHEITLWPIEIVDAKLTAVPPDLPDLQRMLMPHMRLRGALRLRLRTVG
EIKFSQISGLDRLSLYIGGDERIASHLFELVHAGGIASVVRAHGATRDDCTFVPKNPVDF
EGLRPDQSLLPQMWNTFHGHNLLHEYFTCRQRFYFFVLTQLQAGLSKIDGNEAEIVLLLD
RLPDELTAHVDASSFQLFCTPIINLFPRRTDRIEINRALTAFHLIPDRSRPLDYEVFSVS
RVFGQKAETSTEVTFNPLYQTLHSDIGNYGRYFSILREPRAMSANARKYGTRSEYVGTEV
FVSLVDQAEAPYDDAIRYLSVDAWLTNRDLPRLIPRNGFSDLTMQDSVPIEGVSLVHPPS
TPREPYATGETAWRLIRQLSFNYMPLAELDHRDGGQALRNMLRLFVGTSEHEQRTQIESL
VGARTEPVVRRLPGHGLLVYGRGVRCELTVDESGFSGVSPYLFGLVLEQYLARHVSINVF
TETELRSMQRGVVTRWKPRMGGRGAV
NT seq 1881 nt   +upstreamnt  +downstreamnt
atggatcccagatttctcgaccactacaatcgcgaactgacctacatgcgcgagctgtcg
gcggagttcgccgcacagcatccgaagatcgcccgccggctcggcatgcacggcatcgaa
acggccgatccttacgtggagcggatgatcgaagcgttctgcttcatgtcggcgcgtacg
cagctcaagctcgacgccgaattcccgcgctttacgcaacgcctgctcgaggtcgtgtat
ccgaactacgttgcgccgacgccgtcgatggccgtggcgaagctacgcccgagcctgcgc
gaaggcaacttcagcaagggcttcacggtgccgcgccacagcgtattgcgctcgtcgatc
ccaccaggcgaacggaccgcctgcgagtttcgcagcggtcatgaaatcacgctttggccg
atcgagatcgtcgacgcgaagctgaccgccgtgccgccggaccttcccgacctgcagcgc
atgctgatgccacacatgcggctgcgcggcgcgcttcggttgcggctgcgcacggtcggc
gaaatcaagttctcgcagatcagcgggctcgaccggctgtcgctctatatcggcggcgac
gagcggatcgcgtcgcatctgttcgaactggtccatgccggcggcatcgcgtcggtcgtg
cgcgcacacggcgctacccgcgacgattgcacgttcgtcccgaagaatccggtcgatttc
gagggcctgcgccccgaccagagcctgttgccgcaaatgtggaatacgttccacgggcac
aatctgctgcacgagtacttcacttgtcggcagcgcttctatttcttcgtgcttacgcag
ttgcaggccggcctttcgaagatcgacggcaacgaagcggaaatcgtgctactgctcgac
cgactgccggacgagctgacggcccacgtcgatgcgtcgagctttcagttgttctgcacg
ccgatcatcaacctgtttccgcgacgcaccgaccggatcgagatcaatcgggcgctgacc
gcgttccacctgattccggaccgcagccgcccactcgactatgaagtcttctcggtatcg
cgggtattcggccagaaagccgaaacgtcgaccgaagtgacgttcaatccgctgtaccag
acgctacacagtgatatcggcaattacgggcgttacttttcgattctgcgcgagccgcgc
gcgatgtcggccaacgcgcgcaaatacggcacccgcagcgagtacgtcggcaccgaagta
ttcgtgtcgctcgtcgatcaggccgaagcgccctacgacgacgcgatccgctatctgtcc
gtcgacgcgtggctcaccaaccgcgacctgccgcgcctgattccgcgcaacgggttcagc
gacctcacgatgcaggactccgtgccgatcgaaggcgtgagtctcgtgcatccgccaagc
acgccgcgcgagccgtacgcgaccggcgaaaccgcatggcggctgattcgccagttgagc
ttcaactacatgccgctcgcggagctcgatcatcgcgacggcggccaggccctgcgcaac
atgctgcgactgttcgtcggaacgagcgaacacgaacagcgcacgcagatcgagagcctc
gtcggcgcgcgcaccgaaccggtcgttcgacgcctgcccggccacgggttgctcgtctac
gggcgcggcgtacgctgcgaactgaccgtcgacgagagcggcttctccggtgtgagcccc
tatttgttcggccttgtgctcgagcagtacctggcgcgacacgtatcgatcaacgtcttt
accgagacggaactgcgctcgatgcaacgcggcgtcgtgacacgctggaagccgcgcatg
ggcggacggggagcggtgtaa

DBGET integrated database retrieval system