KEGG   Burkholderia ambifaria MC40-6: BamMC406_3645Help
Entry
BamMC406_3645     CDS       T00684                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BamMC406_3645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bac02044]
    BamMC406_3645
Secretion system [BR:bac02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BamMC406_3645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ACB66112
UniProt: B1Z0J1
Position
2:complement(591574..592059)
Genome map
AA seq 161 aa AA seqDB search
MAIPAYMWLKDDGGADIKGSVTVQDREGSVELVAFDHGVHIPTDGNTGKLTGTRVHKPIT
LTKETDASTPYLYKAVTSGQTLKSVEIKWYRIDDAGKEKEYFNTKLDNVKIVAVKPKMLD
IKNPDYEKHNHLEDVELRYETITWSYKDGNIIHKDTWNERS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcaattccggcctacatgtggctcaaggacgacggtggcgcggacatcaagggttcg
gtaaccgtccaggatcgcgagggtagcgtcgaactggtcgcgttcgatcatggcgtgcac
attccgaccgacggcaatacgggcaagctgaccggcacgcgcgtgcacaagccgatcacg
ctgacgaaggagaccgacgcgtcgacgccgtacctgtacaaggccgtgacgagcggccag
acgctgaagtcggtcgagatcaagtggtatcgaatcgacgacgcgggcaaggaaaaggaa
tacttcaacaccaagctcgacaacgtgaagatcgtcgcggtgaagccgaagatgctcgac
atcaagaaccccgactacgagaagcacaaccatctcgaagacgtggaactgcgttacgag
acgatcacgtggtcgtacaaggacggcaacatcatccacaaggacacctggaacgaacgt
tcctga

DBGET integrated database retrieval system