KEGG   Burkholderia ambifaria MC40-6: BamMC406_3649
Entry
BamMC406_3649     CDS       T00684                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
bac  Burkholderia ambifaria MC40-6
Brite
KEGG Orthology (KO) [BR:bac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bac02044]
    BamMC406_3649
Secretion system [BR:bac02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BamMC406_3649
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACB66116
UniProt: B1Z0J5
Position
2:596614..597126
AA seq 170 aa
MDSFQREIPKSRVSITLDLHTGGAQKKVELPLKLLVAGDFSAGREQAPLAERKKVNIDKN
NFDAVLADYAPDLRIAADNTLAGDGSELPVNLSFRSIKDFAPEQVARQIPELQALLAMRN
LLRDLKSNLLDNGTFRREFEKVLKDDRLSAKLRGELAQIATAATQPEGHA
NT seq 513 nt   +upstreamnt  +downstreamnt
ttggatagctttcagcgagagatcccgaagagccgggtgtcgatcacgctcgacctgcat
acgggtggagcgcagaagaaggtcgagttgcccttgaagctgctggtcgccggcgacttc
agtgccggccgtgagcaggcgccgcttgccgagcgcaagaaggtcaacatcgacaagaac
aacttcgacgccgtgctggccgactatgcgccggatctcaggatcgccgcggacaacacg
ctggccggcgacggttcggagctgcccgtcaacctgtcgttccgctcgatcaaggatttc
gcgcccgagcaggtcgcgcgccagattcccgagctgcaggcgctcctcgcgatgcgcaac
ctgctgcgcgacctgaaatcgaacctgctcgacaacggcacgttccgtcgcgagttcgag
aaggtgctgaaggacgatcgcctgtccgcgaagctgcgcggcgaactcgcgcagatcgcg
accgccgcgacgcagccggaagggcatgcgtga

DBGET integrated database retrieval system