KEGG   Burkholderia ambifaria MC40-6: BamMC406_3659Help
Entry
BamMC406_3659     CDS       T00684                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BamMC406_3659
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bac02044]
    BamMC406_3659
Secretion system [BR:bac02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BamMC406_3659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN Melibiase_2_C DUF5061
Motif
Other DBs
NCBI-ProteinID: ACB66126
UniProt: B1Z0K5
Position
2:615507..616025
Genome map
AA seq 172 aa AA seqDB search
MFYRMSAATAAAVLLLSGCGAWQSVSDASSNAYRAVFFKQVKVLDVDLTARAALNPDDAG
RPTSVAVRVYQLKDRKMFDAASYDDLLKNDRTVLAQDLQANMSATVRPGASSSLSQPMQR
ETKYVAVVALYRVPGSAEDWKRVVEKKRLDPDKPLRIGLTSNRLEMAGDIPK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgttctatcgaatgagtgcggctacggctgccgccgtattgcttctgtcgggctgtggt
gcgtggcagtcggtatcggatgcgtcgtcgaatgcctatcgcgcagtgtttttcaagcag
gtgaaggtgcttgacgtcgatctgactgcacgcgcggcgctgaacccggacgacgcggga
cgaccgacgtcggtggccgtgcgcgtctaccagctgaaggatcgcaagatgttcgatgcc
gcctcgtacgacgatctgttgaagaacgatcgcacggtgcttgcccaggatctgcaagcg
aatatgtcggctaccgtgcgccccggggcttcgtcgagcttgtctcagccgatgcaacgg
gagacgaagtatgtggcggtcgttgcgttgtaccgcgttccgggaagcgccgaagattgg
aaaagagtcgtcgagaaaaagagactcgatccggacaagccgctacggatcggattgacg
tcgaatcggcttgagatggcaggcgacatccccaagtaa

DBGET integrated database retrieval system