KEGG   Burkholderia ambifaria MC40-6: BamMC406_3817Help
Entry
BamMC406_3817     CDS       T00684                                 

Definition
(GenBank) Peptidase S53 propeptide
  KO
K05998  pseudomonalisin [EC:3.4.21.100]
Organism
bac  Burkholderia ambifaria MC40-6
Brite
KEGG Orthology (KO) [BR:bac00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bac01002]
    BamMC406_3817
Enzymes [BR:bac01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.100  sedolisin
     BamMC406_3817
Peptidases [BR:bac01002]
 Serine Peptidases
  Family S53
   BamMC406_3817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro-kuma_activ Peptidase_S8
Motif
Other DBs
NCBI-ProteinID: ACB66284
UniProt: B1Z1K3
Position
2:complement(807578..809317)
Genome map
AA seq 579 aa AA seqDB search
MKRNTWFALPLPSPRHLACAVPLVFAAAAAHAATDWVDTHTKAFLTGPQLMARSAAPSLE
LAAGETTDIVVSLKLRNAAQLKQLAHDVNRPGNAHYRQYLTHEQFLAGYAPTEAQVKSVV
DYLRKSGFVNIEVAPNRLLVSAHGTTGTVKTAFNTSLVHFEYAGRSGFANASTAQVPHAL
GDVVGSVLGLQNVARARPLLRIGNVAKPQALAAGTATGHYPKEFPGLYNATGVPTAAGVT
VGIITIGGVSQTLQDLRQFTSSNGYGTVTTQTVKTNGTGTSGSYSDDQDGQGEWDLDSQS
IVGSAGGQVGKLVFYMADLNAAGNTGLTQAFNRAVSDNTAKVINVSLGWCETDANADGTL
DAEEQIFTTAAAQGQTFSVSSGDEGVYECNNRGYPDGGNYTVSWPAASPHVLAIGGTTLY
TTSAGAFSNETVWNEGLDGNGKLWATGGGVSSILPAPSWQSGSNRQLPDVSFDAAQGTGA
YIYNYGQLQQIGGTSLSAPIFTGFWARLLAANGTGLGFPAGNFYADIPSNPSLVRYDVVS
GNNGYQGYGYSAGSGRDLTTGFGSLNIANLNKLIQTGGF
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaacacctggtttgcgctgccccttccgtcgccccgccacctcgcgtgcgcg
gtaccgctcgtgttcgccgccgccgcggcccatgcggcgacggattgggtcgatacccat
acgaaagcctttctgaccggcccgcagttgatggcgcgcagcgcggcgccgtcgctcgag
ctcgcggccggcgagacgacggacatcgtcgtcagcctgaagctgcgcaacgccgcgcag
ctcaagcaactcgcgcacgacgtgaaccggcccggcaacgcgcattaccgccagtacctc
acgcacgaacagttcctcgccggctacgcgccgaccgaagcccaggtcaagtcggtcgtc
gactatctgcgcaagagcggcttcgtgaacatcgaagtcgcgccgaaccggctgctggtg
tccgcgcacggcacgaccggcacggtgaagaccgcgttcaacacgtcactcgttcatttc
gagtacgcgggccgctccggcttcgcgaacgcgtcgaccgcgcaggtgccgcatgcgctc
ggcgacgtcgtcggctcggtgctcgggctgcagaacgtcgcacgcgcacggccgctgctg
cgcatcggcaacgtcgcgaagccgcaggcgctcgcggccggcacggccaccggccactat
ccgaaggaattcccgggcctctacaacgcgaccggcgtgccgaccgcggccggcgtgacc
gtcggcatcatcacgatcggcggcgtgtcgcaaacgctgcaggacctcaggcagttcacg
tcgagcaacggttacggcacggtcacgacccagaccgtcaagaccaacggcaccggcacg
agcggcagctacagcgacgaccaggacggccagggcgaatgggatctcgacagccagtcg
atcgtcggctcggccggcggccaggtcggcaagctcgtgttctacatggcggacctgaac
gccgccggcaacaccgggctcacgcaggcattcaaccgcgcggtgtcggacaacaccgcg
aaggtgatcaacgtgtcgctcgggtggtgcgagaccgatgcgaacgcggacggcacgctc
gacgccgaagagcagatcttcacgacggccgccgcgcaaggacagacgttctcggtgtcg
tcgggcgacgaaggcgtgtacgagtgcaacaaccgcggctatccggacggcgggaactac
acggtgtcgtggccggccgcgtcgccgcacgtgctcgcgatcggcggcacgacgctctat
acgacgtcggcgggcgcgttctcgaacgaaacggtgtggaacgaggggctcgacggcaac
ggcaagctatgggccacgggcggcggcgtcagctcgatcctgccggcgccgtcgtggcag
tcgggcagcaaccgtcagttgcccgatgtatcgttcgacgccgcgcaaggcacgggcgcg
tacatctacaactacggccagttgcagcagatcggcggcacgagcctttccgcgccgatc
ttcaccggcttctgggcgcgtctgctcgcggcaaacggcacgggcctgggcttcccggcc
ggcaatttctatgcggacattccgtcgaacccgtcgctcgtgcgctatgacgtcgtctcg
ggcaacaacggctatcaagggtatggctacagcgcaggcagcggccgggatctgacgacc
ggcttcggcagcctgaacatcgcgaacctcaacaagctgatccagacgggcggcttctga

DBGET integrated database retrieval system