KEGG   Burkholderia ambifaria MC40-6: BamMC406_3870Help
Entry
BamMC406_3870     CDS       T00684                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00040  Pentose and glucuronate interconversions
bac00052  Galactose metabolism
bac00500  Starch and sucrose metabolism
bac00520  Amino sugar and nucleotide sugar metabolism
bac01100  Metabolic pathways
bac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BamMC406_3870
   00052 Galactose metabolism
    BamMC406_3870
   00500 Starch and sucrose metabolism
    BamMC406_3870
   00520 Amino sugar and nucleotide sugar metabolism
    BamMC406_3870
Enzymes [BR:bac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BamMC406_3870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ACB66337
UniProt: B1Z203
Position
2:866247..867134
Genome map
AA seq 295 aa AA seqDB search
MLKVTRAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKPSHVNCFYVRQPEALGLGHAVLCAEK
LVHGEPFAVILADDLLHGEQPVLKQLVDVFDHYHSSVIGVETIPREDSRSYGVVEGREWE
EDIIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRKLKPGAGGELQLTDAVQSLLA
NEQVLAYRYFGTRFDCGSKIGYLKATVELALQHPEVSREFEAYLRTCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccagggccgtgtttcccgttgccggtctcggcacgcggttcctcccg
gcaacgaaggcgagcccgaaggaaatgctgcccgtcgtcgacaagccgctgatccagtac
gcggtcgaggaagcgatcaacgccggtattaccgagatgatcttcgtgacggggcgcagc
aagcgcgcgatcgaggaccacttcgacaagtcctacgagatcgaggccgaactcgaggcg
cgcggcaaggaaaagctgctcgagctcgtgcgcggcatcaagccgagccacgtgaactgc
ttctacgtgcgccagccggaagcgctcggcctcggccatgcggtgttgtgcgcggaaaag
ctcgtgcacggcgagccgttcgcggtgatcctcgccgacgacctgctgcacggcgaacag
ccggtgctcaagcagctcgtcgacgtgttcgaccactatcacagctcggtgatcggggtc
gagacgatcccgcgcgaggacagccgctcgtacggcgtcgtcgaaggccgcgagtgggaa
gaggacatcatcaagctgtcgggcatcatcgagaagccggcgccggaagacgcgccgtcg
aacctcggcgtggtcggccgctacgtattcatgccgacgatcttcgatcatctgcgcaag
ctcaagccgggcgccggcggcgaactgcagctgaccgacgccgtccagtcgctgctcgcg
aacgaacaggtgctcgcgtatcgctacttcggcacgcgtttcgattgcggcagcaagatc
ggttatctcaaggcgaccgtcgagctcgcgctccagcatccggaagtgagccgcgaattc
gaggcgtacctgcgtacctgcctgcccgcgctggctgctgtcgcataa

DBGET integrated database retrieval system