KEGG   Burkholderia ambifaria MC40-6: BamMC406_4416Help
Entry
BamMC406_4416     CDS       T00684                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BamMC406_4416
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BamMC406_4416
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BamMC406_4416
    1.1.1.-  
     BamMC406_4416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C DAO
Motif
Other DBs
NCBI-ProteinID: ACB66872
UniProt: B1YX10
Position
2:1499873..1500937
Genome map
AA seq 354 aa AA seqDB search
MKAAVWHGRNDIRVEEVPVPAHPPAGWVQIRVHWCGICGSDLHEYVAGPVFIPVDAPHPL
TGLKGQCILGHEFSGEIAALGAGVTGFAVGDRVTADACQHCGTCWYCKHGLYNICENLAF
TGLMNNGAFAEYVNVPAELLYKLPENFPTEAGALIEPLAVGLHAVKKAGNIVGQTVVVVG
AGTIGLCTIMCAKAAGAGRVIALEMSAARKQKALEVGATVVIDPKASDAIAEIKALTGGY
GADVSFECIGHTATAQLAIDVIRKAGKSVMVGIFEEPTSFNFFDIVSTEKEVIGSLAYNG
EFADVIRFIADGRIDVQPLITGRIALGDIVTHGFQELVNHKDRNVKIIVQPATA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtctggcacggccgcaacgacatccgcgtcgaagaggttcccgttccg
gcgcacccgccggccggctgggtccagatccgcgtgcactggtgcggaatctgcggctcc
gacctgcacgaatacgtcgccgggccggtgttcatcccggtcgacgcgccgcacccgctg
acgggcctgaagggccagtgcatcctcggccacgagttcagcggcgaaatcgcggcgctc
ggcgcgggcgtgacaggtttcgccgtcggcgaccgcgtgacggccgacgcgtgccagcat
tgcggcacctgctggtattgcaagcatgggctctacaacatctgcgagaacctcgcgttc
accgggctgatgaacaacggcgcgttcgccgaatacgtgaacgtgccggccgagctgttg
tacaagctgcccgagaacttcccgaccgaggctggcgcgctgatcgaaccgctcgcggtc
gggctgcacgcggtgaagaaggccggcaacatcgtcggccagaccgtcgtcgtggtcggc
gccggcacgatcggcctgtgcactatcatgtgcgcgaaggccgcgggcgccggacgcgtg
atcgcgctggaaatgtcggccgcgcgcaagcagaaggcgctggaagtcggcgcgacggtc
gtgatcgatccgaaggcgtcggatgcgatcgcggaaatcaaggcgctgacgggcggctac
ggcgccgacgtgtcgttcgagtgcatcgggcacacggccaccgcgcagctcgcgatcgac
gtgatccgcaaggccggcaagtcggtgatggtcggcatcttcgaggagccgacgtcgttc
aacttcttcgacatcgtgtcgaccgagaaggaagtgatcggctcactcgcgtacaacggc
gaattcgcggacgtgatccgcttcatcgccgacggccgcatcgacgtgcagccgttgatc
accgggcggatcgcgctcggcgacatcgtcacgcacggcttccaggagctggtcaaccac
aaggaccggaacgtgaagatcatcgtccagcccgcgacggcctga

DBGET integrated database retrieval system