KEGG   Burkholderia ambifaria MC40-6: BamMC406_5443Help
Entry
BamMC406_5443     CDS       T00684                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00051  Fructose and mannose metabolism
bac01100  Metabolic pathways
bac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BamMC406_5443
Enzymes [BR:bac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BamMC406_5443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ACB67887
UniProt: B1Z2C5
Position
2:complement(2682561..2683343)
Genome map
AA seq 260 aa AA seqDB search
MAETLNLTKETLVALAERRLENEVGDSGWSPRQKLALTCRILFDAGHDSGLAGQITCRAG
DAGTYYTQRLGLGFDEISAANLLRVNEDLDVVDGEGIPNPANRFHTWIYRERPDVNCIIH
THPAHVAALSMLEQPLVVSHMDTCPLYDDCAFLKDWPGVPVGNEEGEIISKALGDKRAIL
LSHHGQLVVGRTIEEACILALLIERAAKLQLLAMSAGEIKPVPPALAREARDWISKPKRD
AVTFDYYARRALRTHPDCIA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacgttgaatttgacgaaggagacgctggtcgcgctggcggagcggcgtctc
gagaacgaggtgggcgacagcggctggtccccgcggcaaaagctcgcgctcacgtgccgg
atcctgttcgacgccggtcacgattcgggcctggccgggcagatcacctgccgcgcgggc
gacgccggcacgtactacacgcagcggctggggctcggcttcgacgagatctcggccgcg
aacctgctgcgcgtgaacgaggatctcgacgtcgtcgacggcgaaggcattccgaacccg
gccaaccggttccatacgtggatctatcgcgagcgcccggacgtgaactgcatcatccat
acgcacccggcgcatgtcgcggcgctgtcgatgctcgagcagccgctcgtcgtgtcgcac
atggacacctgcccgctgtacgacgattgcgcgttcctgaaggactggcccggcgtgccg
gtcggcaacgaggaaggcgagatcatttcgaaggcgctcggcgataaacgcgcaattctg
ctgtcgcatcacggccagctcgtggtgggcaggacgatcgaggaagcctgcatcctcgcg
ctgctgatcgagcgggccgcgaagctgcaactgcttgcgatgtcggccggcgagatcaag
ccggtgccgccggcgctcgcgcgggaagcgcgcgactggatttcgaagccgaagcgcgat
gccgtgacgttcgactactacgcgcggcgcgcgttgcgcacgcatccggactgtattgca
tga

DBGET integrated database retrieval system