KEGG   Burkholderia ambifaria MC40-6: BamMC406_6506
Entry
BamMC406_6506     CDS       T00684                                 
Name
(GenBank) type IV secretory pathway VirB4 components-like protein
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bac00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BamMC406_6506
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bac02044]
    BamMC406_6506
Enzymes [BR:bac01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BamMC406_6506
Secretion system [BR:bac02044]
 Type IV secretion system
  Trb secretion system protein
   BamMC406_6506
SSDB
Motif
Pfam: CagE_TrbE_VirB AAA_22 FtsK_SpoIIIE AAA_16 AAA_10 T2SSE
Other DBs
NCBI-ProteinID: ACB68931
UniProt: B1Z654
Position
pBMC401:complement(4991..7468)
AA seq 825 aa
MLSSKIKRGPMQEIAPWATMVTPELVLDKDGSLLTVFTFDGIDADSPNKADISAARDNLD
HACKNFDHRVTAWWRLSHRRVRGDIQGGFSSRIDERIDAINRAHVSSGKFFRNTHSLALA
YTPETGINKIFEKVAYHMTVGGKSVPVALWETLRDVLFARSAFAFDMERITSDIKRFEGV
IDAFKGGVTRLKMKRLQLQNVMAFLHQTANPSVPPRRVRYPVTMLDTHLTETFVTYGTEH
LMFESAYGKRYAKIVSVKEWMGFQEAALDVLADVDAELDICVMFRFLSSHKARVYIEKMR
KFYKVAAFNPLAILKSFFSKDEKQEAEKNDKGREILAEEAENALAKLVADGTQYGFANIS
VVVYGDTVEECDDNTREVVGRIGNAGFGVILETRNIPAAWATTLPGRWDQQKRLQFVETP
CVSDIAPLRGVEEGSPINQWLTQQTGEQTGPLTVLPTRHRTLQRVTLHQPGGKSHTLVVG
PIGAGKTIFLNFLVSQSGRHNPRRIKFDKNRSTRIPTVMANGRFVDATGRFGAATPVNPL
SLLADKRHWTYVAEWVQMAIEDEDFHCTPQQQTDIYQAVATLGGGEYDRELWTLSMLNTL
LPMELRERLQIWTQGEKNGRFFDHVEDAFSLSDDIAIEMGDLFEKYPVAAALFMDYAFYR
ISQWLDGKRFTIIEVEECGFFFQYERFYARLELWAVTIRGLNGTLVMATQSLGQLARVKN
FEILKENIPNFFFLPNRDARNNKHLYRDVFGLTDDLIDMIADAVPNRDYLWVTPDHARML
QAQFPKEALAVLRADGAAQRVLDKHHDSGSPHWREEYLQEMMTLD
NT seq 2478 nt   +upstreamnt  +downstreamnt
atgttgagttcgaaaatcaagcgcggcccgatgcaggagatcgcgccgtgggcgacgatg
gtcacccctgagcttgtcctggacaaggatgggtcgctgctgacggtgttcacgttcgac
ggaatcgacgccgactcgccgaacaaggcggatatttcggcagcgcgagacaacctcgat
catgcgtgcaagaacttcgaccaccgggtaacggcgtggtggcgactgtcgcatcggcgt
gtccgtggggacatacaggggggattctcgtcccggatcgacgagcgcatcgatgccatc
aaccgcgcacacgtcagcagcggcaagtttttccgcaacacccattcgctggcgctggct
tacacgcccgagaccgggatcaacaagatcttcgagaaggtcgcgtaccacatgacggtc
ggcggcaagtcggtgccggtcgctctgtgggaaaccctccgggacgtgctttttgcacgc
agcgctttcgcgttcgacatggagcggattacgtcggacatcaagcggttcgagggggtt
atcgacgctttcaagggcggcgtgacgcgcctcaagatgaagcgcctgcaactgcagaac
gtcatggcgttcctgcaccagaccgcgaacccctccgttccgccgcgccgcgttcgctac
ccggtcacgatgctggacacccatttgaccgagacgttcgtgacgtacggcacggagcac
ctgatgttcgagtcagcgtacggaaagcggtacgcgaagatcgtgtccgtgaaggaatgg
atggggtttcaggaggccgccctcgatgtcctggcggacgtcgacgccgagctcgacatc
tgcgtcatgttccgcttcctgtcgagccacaaggcgcgggtctatatcgagaagatgcgc
aagttctacaaggtcgcggcgttcaacccgcttgcgatcctgaagagcttcttctcgaag
gatgaaaagcaggaggcggaaaagaacgacaaggggcgtgaaatccttgccgaagaggct
gaaaatgcactggcgaaactggtggccgatgggacgcagtatgggttcgccaacatctcg
gtggtcgtctatggagacacggtcgaggagtgcgacgacaacacgcgcgaagtcgtcggc
cgcatcggcaatgcggggtttggcgtcatcctggagacccgcaacatcccggcggcgtgg
gcgaccacgttgcccggacggtgggatcagcaaaaacgcctgcagttcgtcgaaacgccg
tgcgtttccgacattgcgccgttgcgcggggtcgaggaaggcagtccgatcaaccagtgg
ttgacccaacagaccggcgagcagactgggccgcttaccgttctgcccacccgtcaccga
acgctgcagcgcgtgacgctgcaccaaccgggcggcaagtcgcacacgctcgtggtcggg
ccgatcggggcgggcaagacgatcttcctgaactttctcgtgtcgcagtccgggcgccac
aacccgcgccggatcaagttcgacaagaaccggtcgacacggattccgacggtgatggcc
aacggtcgctttgtcgatgcgactgggcggttcggcgcggccacgccggtcaacccgctt
tcgctgctggcggataagcggcactggacctacgtggcggaatgggtgcagatggcgatc
gaggatgaggacttccactgcacgccgcagcagcagacggatatctatcaggctgtcgca
acgctcggcggcggcgagtacgaccgcgaactctggacgctgtcgatgctgaacacgctg
ttgccaatggagctgcgcgagcgcctccagatctggacgcaaggtgagaagaacggtcgc
ttctttgatcacgtcgaggatgcgttctcgctgtcggacgatatcgcgatcgagatgggc
gacctgttcgagaaatacccggtcgccgccgcgctattcatggactacgcgttctatcgc
atctcgcaatggctggacgggaagcgcttcacgatcatcgaagtcgaagagtgtgggttc
ttcttccagtatgaacgcttctatgcccgcctggaactgtgggccgtcacgatccgcggc
ttgaacgggacgctcgtgatggcgacccaatcgctcgggcagctcgcccgcgtgaagaac
ttcgagattctcaaggagaacatcccgaacttcttcttcctgccgaaccgggacgcacgc
aacaacaagcacctgtatcgggatgtgttcggcctgaccgacgacctgatcgacatgatt
gccgacgcggtgcccaaccgcgattacctgtgggtgacccctgaccacgcacggatgctc
caggcgcaattcccgaaagaagctctcgccgtgttgcgcgccgacggcgcggcccaacgg
gtgctcgacaaacaccacgactccggctcgccgcactggcgtgaagagtacctccaagaa
atgatgactctcgactga

DBGET integrated database retrieval system