KEGG   Burkholderia ambifaria MC40-6: BamMC406_6508Help
Entry
BamMC406_6508     CDS       T00684                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bac  Burkholderia ambifaria MC40-6
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC DUF4418 YtpI ApoO
Motif
Other DBs
NCBI-ProteinID: ACB68933
UniProt: B1Z656
Position
pBMC401:complement(7766..8146)
Genome map
AA seq 126 aa AA seqDB search
MKKLFNAFAHSASTKVCGAANYLFGRGQIRSTLIAAAIAFATPAAHAVDLSDLGNAASMI
CLIQAYVSGPVLFCIGIVVIIMAAIMIANSESNIVKFLATVFIGLGVAACAIPIVKNRMH
IDYTCA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttgttcaacgcttttgctcactcggcgtccaccaaagtatgcggcgccgcg
aactacctgttcggtcgcggccagatccgctccacattgatcgctgctgcgatcgcgttt
gccacaccggcagcccatgcggtggatctgagcgatctcggcaacgcagcgtcgatgatc
tgtctgatccaggcctatgtgagcgggccggtgctgttctgtatcggcatcgtggtgatc
atcatggccgcgatcatgatcgcgaactccgagagcaacatcgtcaagtttctcgcgacc
gtcttcatcggcctcggtgtcgcggcgtgtgcgattccgatcgtgaagaaccgcatgcac
atcgactacacctgtgcgtaa

DBGET integrated database retrieval system