KEGG   Burkholderia ambifaria MC40-6: BamMC406_6672
Entry
BamMC406_6672     CDS       T00684                                 

Definition
(GenBank) OmpA/MotB domain protein
Organism
bac  Burkholderia ambifaria MC40-6
SSDB
Motif
Pfam: OmpA
Other DBs
NCBI-ProteinID: ACB69076
UniProt: B1Z6J9
Position
pBMC401:168180..169838
AA seq 552 aa
MNVRSMKERALVWITTPVFVFGCAWALAELGEWWSAAIVLLLVALAVCISGWYERRCATR
AVGAESTDALGNTPRELAVIVVVGPYAASLFPRDAGRTMLRRDDRAVWLLADTPARLSSV
MTQVKASRGRFPDAALLPVVPEGDDESALRREFAHWRIALQGSYCHPECVLPCHVAVYGC
LGPAEDKMPQTRWFGDPVDIDVQRVENAMRPYDRLPAIRRQLAASRQPSAVMRSALGLAV
FDWLDEAALLSSISTLANAAPFALRGVSLADVGYMSVRPGAWTRWLIARTGLQPRITKPL
TGPLPLPFVRASRPQVDARRSALLSRSRAWPLGLHVLLSSVVALTATVAISGWTNYRIVE
RIAGNLSAYRNTPGNRITAKVDSFERLRADRDEVARNLRDGVPFGAGWGLYPGRALLVRL
NAGLAGYRPPLTTVQIDSLSLFASGKATFSPEAAHRELAHALQLIQANPDQRVLIEGHAD
SEGSPRANILLSEARARAIRDWLAAKGGLSVARFAIQGLGDVRPIADNSSEAGRALNRRV
DVSLFPDSTLRR
NT seq 1659 nt   +upstreamnt  +downstreamnt
gtgaatgttcgatcgatgaaggagagggcgctggtttggatcacgacgccggtattcgta
ttcggctgcgcgtgggcactcgccgagctgggtgaatggtggagtgcagcgatcgttttg
ctgctcgtcgcgttggccgtctgcatctccggctggtacgagcgccgatgcgcgacgcgt
gcggtcggcgccgaatccaccgacgcactcggcaacaccccacgagaactcgcggtgatc
gttgtcgttgggccgtatgccgcgagcttgtttccgcgcgatgcgggacggactatgctt
cggcgagatgatcgggcggtgtggctgttggccgatacgccggcgcggcttagcagcgtc
atgacgcaggtaaaggcgtcgcggggccgttttccggacgccgcgttgctgcccgtggtg
ccggaaggcgacgacgaaagcgcgctgcgccgtgagtttgcacattggcgtatcgcgctg
caggggtcgtactgccatccggaatgtgtgttgccttgccacgtcgccgtgtatggatgt
ttgggccccgccgaagataagatgccgcagacgcgatggttcggcgatccggtcgacatt
gacgtacagcgcgtcgagaatgccatgcggccttatgaccggctgccggcgatccgtcgt
cagctcgcggcgtcgcggcagccgagtgcggtgatgcggagcgcgctcgggcttgcggtg
ttcgattggctcgacgaggccgcattgttgtcgtctatttccacacttgcgaatgcggcg
ccgttcgcgctgcgcggcgtgtcgctggctgacgtcggctacatgtcggtccggccgggc
gcgtggacgcgctggctcattgccagaacgggcctgcagccgcggatcacgaagccgctg
acggggccgctcccgctgccgttcgttcgcgcatcgaggccgcaagtcgacgcgcggcgt
agcgcactgctgtcgcgtagccgcgcatggccgcttgggttgcacgtcctgctgtcgagc
gtggtagcgctgaccgcgacggtggcgatatcgggctggacgaattaccggatcgtcgag
cgcatcgcgggcaacttgtctgcctaccggaacacgccgggaaaccggatcaccgcgaag
gtcgactcgttcgagcggctgcgcgcagatcgcgacgaagtagcgcgcaatttgcgcgac
ggcgtgccgttcggagcgggttggggcctgtatccgggacgcgcgttgttggtccgtctc
aatgctgggcttgcgggctaccggccgccgctaacgactgtgcaaatcgacagcctttcg
ctgttcgcaagtggcaaggcgaccttttccccggaggccgcgcatcgcgaactggcgcat
gcgctgcagctgatccaggcgaaccctgaccagcgcgtgctaatcgaaggacacgccgac
agtgaaggatcgcctcgcgcgaatatcctgctatccgaagctcgcgcccgtgcaatccgc
gattggctggcggccaaaggcggattgtcagtcgcccgtttcgcgatccaggggttgggc
gacgtcaggccgattgcggacaacagcagcgaagccgggcgggcactgaaccggcgcgtt
gacgtttccctctttcctgatagcaccctgcgccgatga

DBGET integrated database retrieval system