KEGG   Burkholderia ambifaria MC40-6: BamMC406_6674Help
Entry
BamMC406_6674     CDS       T00684                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
bac  Burkholderia ambifaria MC40-6
Brite
KEGG Orthology (KO) [BR:bac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bac02044]
    BamMC406_6674
Secretion system [BR:bac02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BamMC406_6674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB DUF1877
Motif
Other DBs
NCBI-ProteinID: ACB69078
UniProt: B1Z6K1
Position
pBMC401:170814..172313
Genome map
AA seq 499 aa AA seqDB search
MAVRESQARAAETQLSAQSDFNALLSREFKPKTEQAREAVESAVKTMAEQALSNSVTMSD
DAYKSIEAIIGEIDRKLSEQINLILHHEEFQQLESAWRGLHHLVTNTETDEKLKIRFMDV
SKEDLRRTMKRYKGVAWDQSPFFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLAS
IGKVAAAAHAPFITGASPAVLQMDSWQELANPRDLTKIFTQNLEYAPWNSLRNSEDSRYI
GLAMPRFLARLPYGIRTNPVDEFDFEEATDGSDHRKYTWANAAYAMAVNINRSFKHYGWC
TLIRGVESGGVVENLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGFIPLIHRKNTD
YAAFIGAQSLQKPAEYHDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERDE
MQQWLNEWIMYYVDADPANSSQETKARRPLAAAEVVVEEVEGNPGYYQAKFFLRPHFQLE
GLTVSLRLVAKLPSVKAAA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggccgtacgtgaatcgcaggcgcgcgctgccgagacgcagctcagcgcgcaatcggac
ttcaacgcgctgctgtcgcgcgaattcaagcccaagacagagcaggcgcgcgaagcggtg
gagtctgccgtcaagacgatggccgagcaggcgctgtcgaactcggtgacgatgtcggac
gatgcctataagagcatcgaggcgatcatcggcgagatcgatcgtaaactgtcggaacag
atcaatcttattctgcaccacgaagaattccagcaattggagagcgcatggcgcgggctg
catcacttggtgacgaacacggaaaccgacgagaagctgaagatccgcttcatggacgtg
tcgaaggaggatctgcggcgcacgatgaaacgctacaagggcgtggcgtgggatcagagc
ccgttcttcaagcagatctacgaagaggaatacggtcagttgggcggcgagccgtacggc
tgtctcgtcgcggactattacttcgaccacacgccgccggacgtcgatctgttggcgtcg
atcggcaaggtcgccgctgcggcgcatgcgccgttcattacgggggcatcgccggccgtg
ctgcagatggattcgtggcaggagttggcaaacccacgtgacctgaccaaaatctttacg
cagaatctcgagtacgcaccgtggaactcgctgcgcaactcggaagactcgcgctacatt
ggcctcgcgatgccgcgcttcctcgcgcgcctgccgtatggcattcgaaccaatccggtc
gacgaattcgatttcgaggaagcgaccgacggctcggatcatcgcaagtacacgtgggcg
aacgcggcctatgcgatggcggtcaatatcaatcgctcgttcaagcactatggctggtgc
acgctgattcgcggtgttgagagcggtggtgtcgtcgaaaacctgccgtgccatacgttc
ccgaccgatgacggcggtattgacatgaagtgcccgaccgagattgcgatttcggaccgg
cgtgaagcggagcttgcgaagaacggcttcattccattgatccaccgcaagaatactgac
tacgcggcgttcatcggtgcgcaatcgctgcagaagcctgccgaataccacgatccggac
gcgactgcgaacgcgaacctctctgcgcgtctgccgtatctgttcgcctgctcgcgtttc
gcgcactacctgaagtgcatcgtgcgggacaagatcggctcgttcaaggaacgggacgaa
atgcagcagtggctcaacgagtggatcatgtactacgtcgatgccgatcccgcgaactcg
tcgcaggaaactaaggcccgtcgcccgctcgccgctgctgaggtggtcgtggaagaagtc
gagggcaatcctggctactatcaggccaagttcttcctgcgtccgcatttccagctggaa
ggactgacggtctcgttgcgcctcgtcgcgaagcttccgtcggtaaaggcggccgcttga

DBGET integrated database retrieval system