KEGG   Burkholderia ambifaria MC40-6: BamMC406_6677Help
Entry
BamMC406_6677     CDS       T00684                                 

Definition
(GenBank) type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
bac  Burkholderia ambifaria MC40-6
Brite
KEGG Orthology (KO) [BR:bac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bac02044]
    BamMC406_6677
Secretion system [BR:bac02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BamMC406_6677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ACB69081
UniProt: B1Z6K4
Position
pBMC401:173642..174991
Genome map
AA seq 449 aa AA seqDB search
MSWFNKVVWSEGLFLLPQLFQQQERYFEHFAHKRAAPLSSFFWGFSQFDIDQESLAFGKL
VFKSGTGIFPDGTPFDVPAHVPPPPPLTIAPEHQNQLIYVAVPLRLPNTEETAFRDQTGS
LARYRAFENELRDSNAIGQGPKPVQLANLRLRLLPEKELTQSWIGIALTRIKALRVDGSV
SLHDTDHIPPVSQYGADPLLREWATQLHGLAKLRADALATRLSGSDGRAGAAAEVADYLL
LQVLNRYEPLLEHICRIRETPPVEFYRELAVMAGELSTFVRPQTRRPLPTPGYDHAQLFG
SIRPLVEEVHYLLNQVLIRGAQPIPLTEQPHGIRVAAVMPAELSGYSSLVLAVGAQMSPD
VLQQQFASQTKISQPQRLPELIRSHLPGLTVVPLPVPPRQIPFNSSYIYYELSRSGPFWE
QIAQQGGLAMHIAGHFPELKVELWGVRHK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagttggtttaacaaggtcgtgtggagcgaaggtcttttcctgcttccccagctgttt
cagcagcaagagcgctattttgaacatttcgcgcacaagcgcgcggcgccgctgagctcg
ttcttctggggattcagccagttcgacatcgatcaggagtcgcttgcgttcggcaagctt
gtgttcaagagcggaaccggcatatttccggacggcacgccgtttgatgtgccggcgcac
gtaccgccgccgccgccgctgacgatcgcgcccgagcatcagaaccagttgatctatgtg
gccgtcccgctgcgtctgcccaatacggaggagaccgcgtttcgcgatcagacgggttcg
ctcgcccgttacagggctttcgaaaatgagcttcgggacagtaatgcgatcggccagggc
ccgaagcccgtgcaactggcgaacctgcgcttgcggcttttgcccgagaaagagttgacg
cagtcgtggatcggcatcgcgctgacgcgcattaaggcattgcgtgtagacggttcggtg
tcgctgcacgacactgatcacattccaccggtcagccaatatggcgccgatccgctgctg
cgggagtgggccactcagttgcacggcctcgcgaagctgcgcgccgatgcgcttgccact
cgtctgtccggtagcgacgggcgtgctggggcggcggcggaagtggccgattacctgttg
ttgcaggtactgaatcgctacgagccgctgcttgaacatatttgccggattcgcgagacg
ccgcccgtggagttctatcgtgaactcgcggtgatggccggcgaactgtcgacgttcgtg
cgtcctcagacgcggcgtccgttaccgacgccgggctacgatcacgcgcagttgtttggg
agcatccggccgctcgtcgaggaagtacattacctgctcaaccaagtactgatacgtggt
gcacagccgattccgctaaccgagcagccacacggcatccgcgtcgctgctgtgatgccg
gccgaactctcgggctattcgagtctcgtgctcgcggtcggcgcgcagatgtcgccggac
gtgctccagcagcaattcgcgtcgcagacgaagatcagccagccgcagcgtctgcccgaa
ctgatccgctcgcatctaccgggcctcacggtggtgccgttgccggttccgccgcgacag
attccattcaattcgagctacatctactacgagctgtcgcggagtggcccgttctgggag
cagatcgcgcaacagggcgggcttgcgatgcacatcgcaggccacttcccggaactgaag
gtcgaactgtggggagtccgtcataaatga

DBGET integrated database retrieval system