KEGG   Burkholderia ambifaria MC40-6: BamMC406_6678Help
Entry
BamMC406_6678     CDS       T00684                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BamMC406_6678
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bac02044]
    BamMC406_6678
Secretion system [BR:bac02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BamMC406_6678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU OmpA DUF1707
Motif
Other DBs
NCBI-ProteinID: ACB69082
UniProt: B1Z6K5
Position
pBMC401:174988..176298
Genome map
AA seq 436 aa AA seqDB search
MSSGTFDKDAFDFLSGDSGALREPQREGRADRRGAPRPLADTGEFDATENIQQRLDEVFA
AENPLLEAARPLLRMLADMPATLDTSEAVDDLRTLLVLEVNLFQKVCDRADLPWKHMAVV
RYCLCTALDEAANRTNWGGGGVWATRGLLITFEGEVDGGEKFFLLIGRMATDPQEYVDIL
EIMYRVLGLGFEGRYSVVADGRRYLEQIRQRLWTLITGARDALQPELSTHWRGAEAGRLP
LLRSVPVWATAACALLALFALFVFYQYHLLSERHVLEARILDIGKDRLVSAPQRLRLSYL
LRNEVARGLLTVDEDDRRSVVVFKGDSMFASGQSTVLPVVEPALGKVGGEVARVGGSVLV
RGHTDNQPIRSAVFPSNLVLSEKRAAYVAQILQQRGTPADRIHAIGKGDTQPVGDNATAA
GRALNRRVEIVVTQQR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgggtacgttcgataaagatgcgttcgactttctgtcgggcgattccggcgcg
ttgcgcgagcctcagagggaaggcagggctgacagaaggggcgcgccgcgcccgctggcc
gacacaggcgagtttgacgcgaccgagaatattcagcagcgtctcgacgaggtgttcgcc
gctgaaaatccgctgcttgaggcggcgcggccgttgctcagaatgctcgccgacatgccg
gccacgctcgacacgtctgaggcggtggacgacctgcggacgctgctcgtgctcgaggtc
aacctgttccagaaagtgtgcgatcgggccgatctgccgtggaagcacatggcggtcgtg
cgatattgcctttgtaccgcgcttgatgaggcggccaatcgcacgaactggggcgggggc
ggcgtatgggcgacgcggggtctgctgatcacgttcgagggggaagtcgacggcggtgag
aagttcttcctgctgattggccggatggcgactgatccacaggagtacgtcgatatcctc
gaaatcatgtatcgcgtcctaggtctcggatttgaagggcgctacagcgtggtggccgac
ggacgtcgctatctggaacaaattcgccagcgtctgtggacgctcatcaccggcgcgcgc
gatgcgcttcagccggagttgtcgacgcactggcgaggcgcggaggccggcaggctgccc
ctgttgcgcagtgtgccggtctgggccacggccgcctgtgcgctgctcgcgctgtttgcg
ctgttcgtgttttaccagtaccacctgctgtcggagcgccatgtactggaagcgcggatt
ctcgatattggcaaggacaggctggtgtcggcgccgcagcgcctgcgcctgtcgtacctg
ttgaggaacgaggtcgcccgcggcctgttgactgtggacgaggatgaccggcgcagcgtc
gtcgtgttcaagggcgattcgatgtttgcgtcgggccagagcacggtgcttccggtggtc
gagccggcgttgggcaaggttggcggcgaggtggcgcgcgtcggtggcagcgtgctagtg
agagggcatacggacaatcagccgatccgcagcgcggtcttcccgagcaatctcgtcctg
tcggaaaagcgcgcagcgtatgtcgcgcagattcttcagcagcgtggtacgcccgcggat
cgcattcatgcgatcggcaagggcgatacccagccggttggcgacaacgccacggcagct
ggccgggcacttaatcgccgcgtggaaatcgtggttacgcagcaacgctga

DBGET integrated database retrieval system