KEGG   Burkholderia ambifaria MC40-6: BamMC406_6693
Entry
BamMC406_6693     CDS       T00684                                 

Definition
(GenBank) type VI secretion ATPase, ClpV1 family
  KO
K11907  type VI secretion system protein VasG
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BamMC406_6693
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bac02044]
    BamMC406_6693
Secretion system [BR:bac02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BamMC406_6693
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small AAA_5 AAA_16 Sigma54_activat AAA_7 AAA_25 AAA_18 Clp_N TniB Zeta_toxin TsaE NACHT CbiA AAA_14 T2SSE AAA_30 Hpr_kinase_C AAA_6 DUF853
Other DBs
NCBI-ProteinID: ACB69097
UniProt: B1Z6M0
Position
pBMC401:198229..200898
AA seq 889 aa
MTISRQALFGKLSHSLFRSVESATTFCKLRGNPYVELVHWLHQLLQAPDGDLQRIVRHCD
IDAETLDRDVLRALAALPAGASSISDFSHHVETTIERAWVLASLNFGDRRIRGAWLVAAL
VKTPELRRVLLSISPAFGKIPLDSLAEMLPAWIDGSPEAGDAPYDGTDFGGAVPGEVAGA
LAPSMAGGSPLEQYCSDLTARARAGEIDPVVGRELEIRTMIDVLLRRRQNNPLLTGDAGV
GKTAVVEGLARAVVDGDVPPKLADVRLLSLDVGALLAGASMKGEFEARLKGVLEAATKST
VPVILFVDEIHTLIGAGGHAGTGDAANLLKPALARGTLRTIGATTWSEYKRYIEKDPALT
RRFQVLQVPEPEEAAAIDMVRGLARTFSRHHGVVLLDEAIRAAVTLSHRYIPSRQLPDKA
ISLLDTACARVALSQHAPPGELQDVRQRLQAARVECDLIDHEWRIGLGDGDALARSRARI
ADLEREADGVEARWRAQADAAQALLSAREAAAEAQGDVPDAGLHAFERALADLQGETALV
FPEVNEVIVAEIVSDWTGIPVRRMVTDEVTAVLALPDTLSARVIGQSDALLQIGERVQTA
RAGLTDPKKPLGVFLLAGPSGVGKTETALALAEALYGGEQNLITINMSEYQEAHTVSGLK
GAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHGDVHEMFFQVFDKGYMEDGDGRYI
DFRHTTILLTSNAGSDLIASLCADEMLVPDADALRTALVPELLKTFPAAFLGRVTVVPYR
PLAQATLSQIVRLHLDRVVARMADGHGVAFSYAPAVLDYIVDRCLVQETGARLLIGFLEQ
HVLPRLAAQWLDALESKRTLTRVELDLADAGAAPAEAFVFHASGAQADE
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgacgatttcaaggcaagccctgttcggcaaactcagccattcgctattccgcagcgtc
gaatccgcgacgactttttgcaagttgcgcggcaacccttacgtcgagctggtgcattgg
ttgcatcaactactgcaggctcccgacggcgatttgcagcgaatcgttcggcactgcgac
atcgacgccgagacgctcgaccgagacgtgctgcgcgcgctggccgcactgccagccggc
gcgagttcaatcagcgatttttcgcaccatgtcgagaccaccatcgagcgcgcatgggtg
ctggcttcgctgaatttcggcgatcggcggattcgtggcgcgtggctcgtcgccgcgctc
gtcaaaacgcccgagttgcgtcgcgtgctgttgtcgatctcccccgcgttcggcaagatt
ccgcttgatagcctggccgagatgttgcctgcttggatcgacggatcgccggaggccgga
gacgcgccgtacgatggcaccgatttcggtggcgccgtgccgggcgaggtggccggcgcg
ctcgcgccgtcgatggccggcggctcgccgctcgagcagtactgcagcgatctcacggcc
cgggcgcgcgcgggcgagatcgacccggttgtggggcgcgaactcgagatccgcacgatg
atcgacgtgctgttgcgccggcgtcaaaacaatccgctgctcacgggcgatgcgggcgtc
ggcaagacggctgtggtcgagggcctcgcccgagcggtcgtcgacggcgacgtgccgccg
aagctcgccgacgtgcgcctgctgagtcttgacgtcggcgcgctgctcgccggcgcaagc
atgaagggcgagttcgaggcgcgcctcaagggcgtgcttgaggcggcgacgaaatcgacc
gtgccggtcattctgttcgtcgacgagatccacacgctgattggtgcgggcggccacgcc
ggcacgggcgacgccgcgaacctgctgaagccggcgctggcgcgcggcacgctgcggacg
atcggcgcgacgacttggtccgaatacaagcggtatatcgaaaaggacccggcgctgacg
cgccgcttccaggtgctccaggtcccggagcctgaggaggcagccgcgatcgacatggtg
cgcgggctcgcgcggaccttctctcggcatcacggggtcgtcttgcttgacgaggcaatt
cgcgcggcggtcacgctgtcgcatcgctacattccgtcccggcaactgccggataaggcg
atcagcctgctcgatactgcctgcgcacgcgtggcgctgtctcagcacgcgccgccgggc
gagctgcaggacgtgcgccagcgattacaggccgcgcgcgtcgaatgcgacctgatcgac
catgaatggcgcatcggtctcggcgacggggacgcgctggcccgctcgcgggcgcgcatt
gcggatctggaacgggaggcggacggcgtcgaggcgcgctggcgggcgcaggccgatgcc
gcgcaggcattgttgagcgcgcgggaggcggccgccgaagcccagggcgacgtgccggac
gctggattgcatgcgtttgagcgcgcgctcgcggatctgcagggcgagacggcgctcgtc
ttcccagaagtgaatgaggtgatcgtcgccgaaatcgtgtcggactggaccggcattccg
gtgcgcaggatggttaccgacgaggtcacggcggtgctcgcgctccccgacactctgtcg
gcccgtgtgatcgggcagtcggatgcgttgctgcagatcggcgagcgggtgcagaccgcg
cgcgcagggctgaccgacccgaaaaagccgctgggcgtcttcctgcttgccggcccgtcg
ggcgtgggcaagacagagacggcgctggcgcttgccgaggcgctgtacggcggtgagcag
aacctgatcacgatcaacatgagcgagtatcaggaggcccatacggtttccgggttgaag
ggcgcgccgcctggctatgtcggttacggcgagggaggcgtactgaccgaggcagtgcgg
cgccggccgtattcggtcgtcctgctcgacgagatcgagaaggcgcatggcgatgtccat
gagatgttctttcaggtgttcgataagggttatatggaagacggcgacggccgctacatc
gatttccgccacacaacgatcctgctcacgagcaatgctggctccgatctgatcgcgagc
ctgtgtgcggacgaaatgctcgtgcccgacgcggacgcgctgcgcacggcgctcgtaccg
gaattgctgaagacgttccctgcggcatttctcggtcgcgtgacggtggtgccgtaccgg
ccgctcgcgcaggcgacgctttcgcaaatcgtgcgcctgcatctggaccgcgtcgtcgcc
cgcatggccgacggacacggcgtggcgttcagctacgcgccggccgtgctcgattacatc
gttgaccgttgtctagtgcaggaaacgggggcgcgcttactgatcgggtttctcgagcag
cacgtgctaccgcgactcgccgcgcaatggctcgacgcgctggagtcgaagcgcacgctc
actcgcgttgagctcgatttggccgacgcgggcgcagcgccagcggaggcattcgtgttc
catgcgtccggcgcgcaagcggatgaatga

DBGET integrated database retrieval system