KEGG   Bacillus sp. BH072: OY17_02120Help
Entry
OY17_02120        CDS       T03582                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00010  Glycolysis / Gluconeogenesis
bacb00053  Ascorbate and aldarate metabolism
bacb00071  Fatty acid degradation
bacb00280  Valine, leucine and isoleucine degradation
bacb00310  Lysine degradation
bacb00330  Arginine and proline metabolism
bacb00340  Histidine metabolism
bacb00380  Tryptophan metabolism
bacb00410  beta-Alanine metabolism
bacb00561  Glycerolipid metabolism
bacb00620  Pyruvate metabolism
bacb00625  Chloroalkane and chloroalkene degradation
bacb01100  Metabolic pathways
bacb01110  Biosynthesis of secondary metabolites
bacb01120  Microbial metabolism in diverse environments
bacb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OY17_02120
   00053 Ascorbate and aldarate metabolism
    OY17_02120
   00620 Pyruvate metabolism
    OY17_02120
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OY17_02120
   00561 Glycerolipid metabolism
    OY17_02120
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OY17_02120
   00310 Lysine degradation
    OY17_02120
   00330 Arginine and proline metabolism
    OY17_02120
   00340 Histidine metabolism
    OY17_02120
   00380 Tryptophan metabolism
    OY17_02120
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OY17_02120
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OY17_02120
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OY17_02120
Enzymes [BR:bacb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     OY17_02120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJE76989
Position
427659..428996
Genome map
AA seq 445 aa AA seqDB search
MDQHIKADIKRVFELQKKNQKTLRASTAGQRREKLQRFLDAVTAHEEEIIEAIRRDVRKP
YHEVKRAETQGTIKAIKDNMNNLDTWMAPKRVGSSVSPDADGVLMYEPKGVTLILGPWNY
PFMLTMAPLAAAIAAGNSAIVKLSDFTMETSHIAATVIREAFQEEEVAIFEGEVDVATEL
LDQPFDHIFFTGSTNVGKIVMTAAAKHLSSVTLELGGKSPTIIDSGYDLMDAAKKIAVGK
FVNAGQTCIAPDYLLMKKEVQSTFTDLLQTIVNAGFMEDDHTVDRNKFTQIVNDRNFNRV
KALYDDAIEKGAKTAFGGVFDAHDRTISPTVLTNVTPDMKIMQEEIFAPILPIMNYEDIS
EAVDYITERDKPLALYVFSHNQELIDYVLQHTTSGNASVNDVVVHFTDVNLPFGGVNTSG
IGSYHGVYGFKEFSHEKGVFIQASK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggatcagcatataaaagcagacatcaaacgcgtctttgagcttcagaaaaaaaatcaa
aaaacgctgcgtgcttcaacagccgggcagcgcagagaaaagcttcagcgctttttagat
gccgtcaccgcacatgaagaagaaatcatcgaggcgatcagacgggacgtccgcaagcct
tatcatgaggtgaaaagagcggaaacgcagggaacgatcaaggcgattaaagataatatg
aacaatctcgacacctggatggcgccgaaacgcgtcggctcatccgtcagccccgacgct
gacggcgtattaatgtacgagccaaaaggcgtcaccttaattctcggcccatggaattat
ccgtttatgctgacgatggctccgcttgcggctgccattgcggccggcaacagcgcgatt
gtgaagctgtccgattttacgatggagacgagccatatcgccgcgacagttattcgcgag
gcatttcaagaagaagaagtcgccatttttgaaggtgaggtcgatgtcgccacagaactg
ctcgaccagccgtttgaccacattttcttcaccggaagcacgaatgtcggtaaaatcgtc
atgacggcagcggcgaagcacttgtcgtccgtcacgcttgagcttggcggaaagagtccg
acgatcatcgacagcggctatgatttgatggacgcggcgaaaaaaatcgccgtcggcaaa
tttgtcaatgcggggcaaacatgtatcgcacctgactatctccttatgaagaaagaagtg
cagagcacctttacagatctcctgcaaaccattgtcaatgcaggttttatggaggatgat
catacggttgaccgcaacaaattcacgcagattgtcaacgaccgcaactttaaccgtgtc
aaagccctgtatgatgatgccattgaaaaaggggcgaaaacggcgttcggcggcgtattc
gatgcgcatgaccgcacgatttctccgaccgtgctgacaaacgtcacgcctgatatgaag
atcatgcaggaagaaatcttcgcaccgattctgccgattatgaattacgaagatatcagt
gaagccgttgattacatcactgaacgggacaagccccttgccttgtatgtattcagccat
aatcaggagctgatcgattatgttctgcagcatacgacgtccggcaatgcttctgtcaat
gatgtcgtcgttcatttcactgacgtcaaccttccgttcggcggtgtcaatacgagcggg
atcggttcatatcacggtgtgtacggctttaaagaattttctcatgaaaaaggcgtattt
attcaagcctctaaataa

DBGET integrated database retrieval system