KEGG   Bacillus sp. BH072: OY17_02985Help
Entry
OY17_02985        CDS       T03582                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00450  Selenocompound metabolism
bacb00970  Aminoacyl-tRNA biosynthesis
bacb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    OY17_02985
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    OY17_02985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bacb01007]
    OY17_02985
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bacb03016]
    OY17_02985
Enzymes [BR:bacb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     OY17_02985
Amino acid related enzymes [BR:bacb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   OY17_02985
Transfer RNA biogenesis [BR:bacb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    OY17_02985
 Prokaryotic type
   Other AARSs
    OY17_02985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AJE77141
Position
595817..597808
Genome map
AA seq 663 aa AA seqDB search
MPQDNNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQ
QKAEEENITPQAYVDRAVAEIQKLWKQLDISHDDFIRTTESRHKEIIEKVFQKLLDNGDI
YLDEYEGWYSIPDETFYTETQLVDVERNEKGEVVGGKSPDSGHPVELIKEESYFFRMSKY
ADRLLKFYEENPSFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPGNPKHVVYVW
IDALFNYITALGYDTENDELYKKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVF
AHGWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERIN
YDLANDLGNLLNRTVAMIQKYFDSEIGSYEGNVTDFDSELSSVAGETVKAYEKAMENMEF
SVALSTLWQLISRTNKYIDETAPWVLAKDQEKEKELRSVMYHLAESLRISAVLLQPFLTQ
TPEKMFAQLGVEDQSLKAWDSIQTFGQLKNTKVKKGEPLFPRLEAEEEVAYIKQKMQGTA
PAKEEKAEEPQEAERLPEITFDQFMDTELRVAEVLSAEPVKKADRLLKLQIDLGFEQRQV
VSGIAKHYTPDQLVGMKIICVTNLKPVKLRGELSQGMILAGESDGVLKVVAVDQSLPKGT
RIK
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagacaataatactttttatattacaaccccgatatattatccgagcggaaaa
ttacatatcggccatgcttatactaccgtggccggcgatgcgatggcgcgttacaaaaga
ttaaaaggatttgacgtacgctatttaaccggaacggatgagcacggacagaaaatccag
cagaaagcggaggaagagaatatcacgcctcaagcttatgtggatcgcgcagttgctgaa
atccaaaaactatggaagcagctcgacatttctcacgatgatttcatccggacgacggaa
agccggcacaaagaaattatcgagaaagtgtttcaaaaacttcttgataatggtgacatt
tacctggatgagtatgagggctggtacagcatccctgatgaaacattctatacggaaaca
cagctggtggatgtggaacgaaatgagaagggtgaggttgtcggcggaaaaagccctgac
agcggacacccggtcgaattaatcaaagaggagtcatacttcttccgcatgagcaaatac
gcagaccgcctgctgaagttttatgaggaaaatccttctttcattcagcctgaatcacgc
aaaaatgaaatgattaacaacttcattaaaccggggcttgaagatttggccgtttccaga
acgacgttcgactggggcgtaaaagtaccgggaaatccgaagcatgtcgtgtatgtatgg
attgacgcactgttcaactatattacagcgctcggttacgatacggaaaatgatgagctt
tacaaaaagtactggccggctgacgtccatcttgtcggtaaagaaattgtccgttttcat
accatttactggccgattatgctgatggcgcttgatctcccgctgcctaagcaagtattc
gcgcatggctggttattgatgaaagacggaaaaatgtcgaaatcaaaaggaaatgtcgtt
gatccggtaacgttaattgaacgctacggcttggatgaacttcgctattacctgcttcgc
gaagtaccgttcggttcagacggtgtctttacgccggaaggtttcgtagaacggattaat
tatgacttggcgaacgacttaggaaaccttctgaatcgtacagtcgcaatgatccaaaaa
tattttgacagtgagattggttcatatgaaggaaatgtgacagattttgattcggagctt
tcttctgtagccggtgaaacggttaaagcttatgaaaaggcaatggaaaacatggagttt
tcagtcgctttatcaacgctatggcaattaatcagccgtacgaacaaatatattgatgaa
actgctccgtgggtgcttgctaaagatcaggaaaaagaaaaagaattacgttctgtcatg
tatcatttagctgaatcattacgtatctcagccgtattgctccagcctttcttgacacaa
acgcctgaaaaaatgtttgcccagctaggagttgaggatcagtctcttaaagcatgggac
agcattcagacattcggccaattgaagaacacgaaagtgaaaaaaggggaaccgcttttc
cctcgtcttgaagctgaagaagaagtagcttacatcaagcaaaaaatgcaaggaactgct
cctgctaaagaagaaaaggcggaagagccgcaagaggcagagcgtcttcctgaaattacg
tttgatcaatttatggatacagaacttcgcgtcgcagaagtcttgtccgcagagccggtg
aaaaaagcagatcggctgctgaaattgcaaattgatctgggctttgaacagcgccaagtt
gtatcaggtatcgcgaagcattatacaccggatcagcttgtgggaatgaagatcatttgt
gtaacgaatctaaaaccggtaaaactgagaggcgagctttctcaaggaatgatactggca
ggagaatcggacggcgttctcaaagtagtagctgtcgaccagtcattaccgaaaggcact
cgaattaaataa

DBGET integrated database retrieval system