KEGG   Bacillus sp. BH072: OY17_03740Help
Entry
OY17_03740        CDS       T03582                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    OY17_03740
Enzymes [BR:bacb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     OY17_03740
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     OY17_03740
    1.1.1.-  
     OY17_03740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C NADH_4Fe-4S ADH_zinc_N_2 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AJE77261
Position
725572..726618
Genome map
AA seq 348 aa AA seqDB search
MKALVWTPNDKLEYQEVDEPQIRKSNDVKVKIFGTGICGTDLNVLKGKMNATHHMIMGHE
SVGAVVEIGPDVTNVKVGDRVVIDPTQFCGKCHYCRRGLTCYCETFEDWQLGIGAHGTFA
EYYVGEDRFMYRIPDSMEWERATLVEPLSCVLNVVDKASIQPEDSVLVLGSGPIGLLVQM
MVKKLARLTVATEIGSFRSEAASRISDYVYHPEALTVDEVKRINQGRKFDVIFDAIGNQL
DWAYPFIEKGGRIVPMGFDDTYEMTVRPYQLLSNGVTIVGTGEARQIMEAALACASDLPQ
LYDFITEKTELKNYEEAIDHLMGIDPVTKERKDISAIKTILVSDPELL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgttggtctggactcctaatgataagcttgaatatcaagaggtggacgagcct
caaattcggaaatccaatgatgtgaaagtgaaaattttcggaaccggtatctgcggaacg
gacttaaatgtgctgaaaggaaaaatgaatgcaacccatcatatgattatggggcatgaa
tcggtgggagcggtcgtggaaatcggaccggacgtgacaaatgtaaaagtcggagaccgc
gtcgtgatagatcctacgcagttttgcgggaaatgtcattattgccggagagggctgacg
tgttattgcgaaaccttcgaggattggcagctcggaatcggggcgcacggaacgtttgcg
gaatattacgtgggggaagacaggttcatgtacagaattccggattcaatggaatgggag
cgggccacattggttgagcctctctcttgtgtgctgaatgttgtggacaaggcttcgatt
cagccggaggactcggtcttggttttggggtcgggaccaatcggattgcttgtgcaaatg
atggtgaaaaaactggcgcgattgacggttgcgactgaaataggcagtttccgaagcgag
gcggcgagccggatatcggattatgtctaccaccctgaagcattaaccgtggatgaagtg
aaacggattaatcaaggaagaaaatttgatgtgatttttgacgcgatcggcaaccagctt
gattgggcttatccttttattgaaaagggaggcagaatcgtgccgatgggctttgatgat
acgtatgagatgacggtcaggccgtaccagctgctgtcaaacggcgtgacgattgtgggc
acaggtgaagcccgccagatcatggaggccgcgttagcatgcgcgtccgaccttccgcag
ctctatgattttattacggaaaagacggaactgaagaattatgaagaagccattgatcat
ctcatgggcatcgacccggtgacaaaagaaagaaaggatatcagcgcaataaaaacgatt
cttgtgtctgatccggaacttttataa

DBGET integrated database retrieval system