KEGG   Bacillus sp. BH072: OY17_03920Help
Entry
OY17_03920        CDS       T03582                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00361  Chlorocyclohexane and chlorobenzene degradation
bacb00625  Chloroalkane and chloroalkene degradation
bacb01100  Metabolic pathways
bacb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OY17_03920
   00361 Chlorocyclohexane and chlorobenzene degradation
    OY17_03920
Enzymes [BR:bacb01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     OY17_03920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AJE77289
Position
763535..764248
Genome map
AA seq 237 aa AA seqDB search
MSHYRTLLFDIDNTLLDFTASETDALQKLFQGSKLDLTAEVEARYKALNQGLWKAFEEGE
MTRDEVVNTRFALLFKEYGLEADGVLMNQAYRQYLEEGHQMIDGAYELIERLSPLFDLYI
VTNGVSRSQYKRLGDSGLYPFFKDVFVSEDTGFQKPMKEYFDYVFARIPGFSAEGGLIIG
DSLSADIKGGQMAGIDTCWFNPGKKANESGIIPTYEIHSLDELYDVLNVERKAAAHL
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagtcattaccgtacgttattatttgatatagacaatacgctgctggattttaccgct
tcagaaaccgatgctcttcaaaaattgtttcaaggttcaaagctggacctgacggcagag
gtggaagcccgttataaagcgttaaatcaagggctgtggaaggcgtttgaagagggggaa
atgacccgcgatgaagtggtgaatacacggtttgcccttttgtttaaagaatacggcctc
gaagccgacggcgtgctgatgaatcaggcgtaccgccaatacttagaagaagggcaccag
atgatagacggagcttatgagctgattgaacggctgagtcctttatttgatttatacatc
gtgacgaacggcgtctcaagatcacaatataagcggctgggcgactccggtctgtatccg
ttctttaaagatgtgtttgtatctgaggacacgggttttcaaaagccgatgaaggaatac
tttgattacgtgtttgcgagaattcccggtttttctgccgagggcggacttattatcggc
gattcactgagcgcggacataaaaggcggtcagatggcgggaattgatacgtgctggttt
aatcccggaaagaaagcaaatgagtccggaatcatcccgacgtatgaaattcattcgctt
gatgagctgtatgatgtgctgaacgtggagcggaaagccgccgctcatttgtaa

DBGET integrated database retrieval system