KEGG   Bacillus sp. BH072: OY17_04445Help
Entry
OY17_04445        CDS       T03582                                 

Definition
(GenBank) dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00010  Glycolysis / Gluconeogenesis
bacb00071  Fatty acid degradation
bacb00350  Tyrosine metabolism
bacb00625  Chloroalkane and chloroalkene degradation
bacb00626  Naphthalene degradation
bacb00680  Methane metabolism
bacb01100  Metabolic pathways
bacb01110  Biosynthesis of secondary metabolites
bacb01120  Microbial metabolism in diverse environments
bacb01130  Biosynthesis of antibiotics
bacb01200  Carbon metabolism
bacb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OY17_04445
  09102 Energy metabolism
   00680 Methane metabolism
    OY17_04445
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OY17_04445
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    OY17_04445
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OY17_04445
   00626 Naphthalene degradation
    OY17_04445
Enzymes [BR:bacb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OY17_04445
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     OY17_04445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C AlaDh_PNT_C FtsJ Shikimate_DH HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AJE77389
Position
876766..877902
Genome map
AA seq 378 aa AA seqDB search
MKALTYQGKEHMEVKEVPAPAIQDERDVIVRITATGICGSDLHLYKNGIPADPGYIVGHE
PMGIVEETGSQVKKLKKGDRVVIPFNIGCGECHYCKHQMESQCDESNPNPHTDAGGLFGF
SEFNGNYPGGQAEYLRVPYADFSSFLVPADSELEDEQVLLLSDVMPTAFWSVQHSGVKKG
DTVVILGSGPIGLMAQKFAWKKGAKRVIAVDQVPHRLEHARRINGAETFNFSEHDEIGKL
LHEQTSGGADVVIDCVGMDGTPLSKEKTEQKPNQFGTISPILTASEAVKKFGTVQLTGAY
ISEADGFPLGDFFTRNVSLKMGQAPVIHLMPMLYQMIEQNEIDPTDIITHKMSLAEAPAA
YDIFDKKEDGNIKVILKP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcactgacataccaaggaaaagaacatatggaagtgaaagaagtcccggcaccc
gccattcaagatgagagagatgtcatcgttcgaatcaccgcaaccgggatatgcggttca
gaccttcatttatataaaaacggaatacccgccgatccgggttatatcgtcgggcatgag
ccgatgggaatcgttgaagaaacgggcagtcaagtcaaaaagctgaaaaaaggcgaccgg
gtcgtgattccttttaacatcggctgcggagaatgtcattattgcaagcaccagatggaa
agccagtgtgatgaatcaaatccaaaccctcatacagatgccggcggcttattcggtttc
tcggagtttaacggtaattatcccggcgggcaggctgaatatttacgtgttccttatgct
gatttctcttcttttctggttccggcagacagtgagcttgaagatgagcaggtgctgctt
ctgtcagatgtcatgccgaccgccttttggagcgtccagcacagcggagtgaaaaaaggg
gatacagtcgttattctgggatcaggcccgatcggcttaatggcgcaaaaattcgcgtgg
aaaaaaggagctaaacgggttatcgcagttgatcaagtcccgcaccgccttgaacatgcg
agacgcataaacggagcagagaccttcaatttttcagaacatgatgagatcgggaaactg
ctgcatgaacaaacgtcagggggcgcggatgtagtgattgattgtgtcggaatggacggc
acgccgctttcaaaagaaaaaacagagcaaaaaccgaatcagttcggaacgatcagtccg
attcttacagcatcagaagccgttaagaagttcggaaccgtgcagctcacgggcgcatac
atttctgaagcggacggctttccgctcggcgattttttcacacgcaacgtttctttaaaa
atgggccaggcacccgttattcatctgatgccgatgctgtatcaaatgatcgaacaaaat
gaaattgatccgacggatatcattacacacaaaatgagtcttgcggaagctcctgctgca
tatgatatatttgacaaaaaagaagatggcaacattaaagtgattttgaagccatag

DBGET integrated database retrieval system