KEGG   Bacillus sp. BH072: OY17_07955Help
Entry
OY17_07955        CDS       T03582                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00071  Fatty acid degradation
bacb00072  Synthesis and degradation of ketone bodies
bacb00280  Valine, leucine and isoleucine degradation
bacb00310  Lysine degradation
bacb00362  Benzoate degradation
bacb00380  Tryptophan metabolism
bacb00620  Pyruvate metabolism
bacb00630  Glyoxylate and dicarboxylate metabolism
bacb00640  Propanoate metabolism
bacb00650  Butanoate metabolism
bacb00900  Terpenoid backbone biosynthesis
bacb01100  Metabolic pathways
bacb01110  Biosynthesis of secondary metabolites
bacb01120  Microbial metabolism in diverse environments
bacb01130  Biosynthesis of antibiotics
bacb01200  Carbon metabolism
bacb01212  Fatty acid metabolism
bacb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OY17_07955
   00630 Glyoxylate and dicarboxylate metabolism
    OY17_07955
   00640 Propanoate metabolism
    OY17_07955
   00650 Butanoate metabolism
    OY17_07955
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OY17_07955
   00072 Synthesis and degradation of ketone bodies
    OY17_07955
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OY17_07955
   00310 Lysine degradation
    OY17_07955
   00380 Tryptophan metabolism
    OY17_07955
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OY17_07955
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OY17_07955
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OY17_07955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacb04147]
    OY17_07955
Enzymes [BR:bacb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OY17_07955
Exosome [BR:bacb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OY17_07955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJE78021
Position
complement(1584555..1585646)
Genome map
AA seq 363 aa AA seqDB search
MEAVITDAKRTIFARENGLLKDCLPEDLAAPLIRHLSRNMPEDIDEVLIGNATGRGGNLA
RLSALAAGLPLSVSGTTIDRQCGSGLDAVRVACHFIKAGAGSMYIAGGAESSSRSPFSSR
ARFSPEHIGDPDMGIAAEYTAQAYGVTRKMQDEYALLSYERSVKANEDGLYRREILPCHG
FAADENMLKKRNMEPLISRAKPVFQSGGSVTAANSCGISDGAAAVCVMEEQKARSLGLKP
RLRFIGSAVSGVHPHYPSAAPVYAVKKLLKERNLSPDDIDIYEINEAFAVKICVFSQQLQ
VPYSKINVRGGALAVGHPYGASGAALVTRLFYEAKRRPDARYAAAAIGSGGGVGLALLFE
VLT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtaattacggatgcgaaacggacgattttcgcccgggaaaacggcctgtta
aaagactgtctcccagaagatttggcagctccgctgatccgccatttgagccggaacatg
cccgaagacattgatgaagtcctgatcggaaacgcgacgggccgcggcgggaatctcgcc
cggctgtcagccttggccgccggacttcctttgagcgtgtccggtacgaccatcgacagg
cagtgcggctccggactggacgccgtgagggtcgcgtgccactttatcaaagccggcgcg
gggagcatgtacatcgcgggaggagcggagagcagcagccgttcccctttctcttcccgg
gcgcgcttttctcctgaacacatcggcgatcctgatatgggcatagcagccgagtataca
gcacaggcttacggcgtaacgagaaagatgcaggacgaatatgcccttctcagctatgaa
cggagcgtcaaagcgaacgaagacggcttataccgccgggaaattcttccctgtcacgga
ttcgccgctgacgaaaacatgctgaaaaagcggaacatggagcctctcatctcccgtgcc
aaacccgtctttcagtccggaggctctgtcaccgccgccaacagctgcggaatttctgac
ggggcggcggcagtttgtgtgatggaagaacaaaaagcgcggtctctcggtttaaagcca
agattgcgttttatcggaagcgcggtaagcggcgtccatccgcattatccgtcagcagcc
ccggtttatgccgtcaaaaagcttttgaaggaacggaacctgtcaccggatgatattgat
atatacgaaatcaacgaggcgtttgccgtcaaaatatgcgttttttcacagcagcttcaa
gtgccgtattctaaaataaatgtccggggcggcgctctggccgtcgggcatccgtacggg
gcttccggggcggcgcttgtcacccggcttttttatgaagcaaaaagacgcccggatgcc
cgctacgcagcagcagcgatcggcagcggaggcggagtcggactggcgcttctctttgaa
gtgttaacgtaa

DBGET integrated database retrieval system