KEGG   Bacillus sp. BH072: OY17_09445Help
Entry
OY17_09445        CDS       T03582                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bacb  Bacillus sp. BH072
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    OY17_09445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AJE78300
Position
complement(1840938..1841936)
Genome map
AA seq 332 aa AA seqDB search
MDTLLLLTILIVICALVFDFINGFHDTANAIATSVSTKALKPRHAIVMAAIMNFLGAMTF
TGVAKTITKDIVNPYTLDNGSVVILAALLAAIAWNLITWYFGIPSSSSHAIIGAIAGAAI
AASGFATLNYKGFIKIIEALILSPIIAFVLGFIVYSIVKLIFKDSNLAKTNKRFRRVQIL
TAAIQSYTHGTNDAQKAMGIITMALMTANLHKSDAIPFWVQLSCALAMGLGTSIGGWKII
KTVGGKIMKIRPVNGVSADLTGAAIIFGATFIHLPVSTTHVISSSILGVGASHRVKGVNW
GTAKRMLITWVITLPIAGTLGAIAFFILDLFF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatactctattacttttaacgatattaattgtcatatgcgctttggtatttgacttc
attaacggatttcacgataccgcaaacgcaatcgccacctcagtttcgacaaaagcgctg
aagccgcggcacgcaatcgtcatggccgccatcatgaactttctcggagcgatgacattt
accggtgtggcgaaaaccattacaaaggacattgtgaatccttatacattagacaacggg
tcagttgtcattctggcggctctactcgccgcaatcgcctggaacttgatcacatggtat
ttcggcattccgagcagctcttcacatgcgattatcggagcgatcgccggagcggccatt
gcagcgtcaggttttgcgactcttaattataaagggttcattaaaattatcgaagcactt
attttatcaccgatcatcgcctttgttctcggctttatcgtatattcgatcgtgaagctg
atttttaaagacagcaatctggcgaaaacaaataaacgcttccgcagagtgcagattttg
acggctgccattcagtcctatacacacggaacgaacgacgcgcaaaaagcgatgggtatc
attacgatggcgcttatgacggccaatttacataaaagtgatgccattcctttttgggtg
cagctctcttgtgccctggcaatgggtctcggcacatccattggcggctggaaaatcatt
aaaaccgtcggcggaaaaattatgaaaatccgtccggtaaacggcgtatctgccgactta
accggcgcagccattattttcggggccacgtttattcatctccctgtcagcacgacacac
gtcatttcgtcttccattctcggtgtgggcgcttcccaccgcgtaaaaggcgtaaactgg
ggaacggctaaacggatgctcattacatgggtcatcaccctgccgattgcaggtacactc
ggcgccatcgcctttttcatcttagatctgtttttctga

DBGET integrated database retrieval system