KEGG   Bacillus sp. BH072: OY17_12270Help
Entry
OY17_12270        CDS       T03582                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00780  Biotin metabolism
bacb01100  Metabolic pathways
Module
bacb_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
bacb_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
bacb_M00577  Biotin biosynthesis, BioW pathway, pimelate => pimeloyl-CoA => biotin
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    OY17_12270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bacb01007]
    OY17_12270
Enzymes [BR:bacb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     OY17_12270
Amino acid related enzymes [BR:bacb01007]
 Aminotransferase (transaminase)
  Class II
   OY17_12270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase bPH_2
Motif
Other DBs
NCBI-ProteinID: AJE78837
Position
complement(2535137..2536297)
Genome map
AA seq 386 aa AA seqDB search
MDFDGWLLKRLDAVKRDGLYRTLRTQETALKTKGQKRQTWASNDYLGLSKDERLITAAQT
ALSRFGAGSGGSRLTTGNTVWHEKLEQTIADFKQTEAALLFSSGYLANIGVLASLPQKGD
VILSDQLNHASIVDGCRLSKAETIVYRHIDMADLEKKLASVQARNRRFIVTDGVFSMDGT
IAPLDRIMALAKQYQAFVIADDAHATGVLGENGGGTSDYFGVCPDVVIGTLSKAVGTEGG
FAAGSNIFIDFLLNQARTFIFQTALPPSICAASHTAFDIISDMHDTRRELQTSVKTIKTR
LADMGFTVRGGDTPIIPVIIGDAKTAVSAAALLEKKGICAPAIRPPAVPEGESRIRLTVT
ADRSLQDIDELTEAFDSIRKELNINK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtggattttgacggatggctcctcaaaaggctcgatgcggtgaaaagagacgggctgtat
cggacgctgcgaacacaggaaaccgctctcaaaaccaaggggcaaaagcggcagacctgg
gcgtccaatgactatttaggcctgtcaaaagatgagcggctgatcacagctgcgcaaacg
gcgctgagccggttcggagcgggaagcggcggctcacggttaacgacaggaaatactgtg
tggcacgaaaaacttgaacaaacaatcgcggactttaaacagacggaagcggctttattg
ttttcaagcggttacttggcgaatatcggcgtgcttgcctcactgcctcaaaaaggcgat
gtcattttaagcgatcaactgaaccatgcgagcattgttgacggctgccgtttatcaaaa
gcggaaaccatcgtgtaccgccatattgatatggctgatcttgagaaaaaacttgcctcc
gtccaggctcggaaccgccgctttatcgtcacagacggcgtcttcagcatggacggcacc
atcgcgcctcttgaccgcataatggcgcttgcaaagcagtaccaggcatttgtgatagca
gatgacgcgcatgcaaccggtgtactcggggaaaacggcgggggaaccagtgactatttc
ggtgtttgtcctgatgttgtcatcggcacattaagcaaagcggtcggaacggaaggcggt
tttgccgcgggatcaaacattttcattgattttttgctgaatcaggcgcggacgtttatt
tttcagacggccctcccgccgtcaatttgtgcggcttcgcatacggcatttgacatcata
tcagatatgcacgatacgcgccgtgagctgcagacgtctgtcaaaacgataaaaacgcgt
ctggccgatatgggctttaccgtaagaggcggagatacaccgattatccccgtcatcatc
ggtgatgcaaaaacagcggtttcagccgctgcgctgctggagaaaaagggaatctgcgcc
ccggccatccgcccgcccgccgttccggaaggcgaaagcagaatcaggctgaccgttacg
gcggatcgcagcttacaggacatagacgagctgacagaagcatttgattccattagaaaa
gagctgaatataaacaaatga

DBGET integrated database retrieval system