KEGG   Bacillus sp. BH072: OY17_17090Help
Entry
OY17_17090        CDS       T03582                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
bacb  Bacillus sp. BH072
Pathway
bacb00010  Glycolysis / Gluconeogenesis
bacb00020  Citrate cycle (TCA cycle)
bacb00620  Pyruvate metabolism
bacb01100  Metabolic pathways
bacb01110  Biosynthesis of secondary metabolites
bacb01120  Microbial metabolism in diverse environments
bacb01130  Biosynthesis of antibiotics
bacb01200  Carbon metabolism
Module
bacb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bacb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OY17_17090
   00020 Citrate cycle (TCA cycle)
    OY17_17090
   00620 Pyruvate metabolism
    OY17_17090
Enzymes [BR:bacb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     OY17_17090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_16 AAA_24 AAA_33
Motif
Other DBs
NCBI-ProteinID: AJE79749
Position
3542404..3543987
Genome map
AA seq 527 aa AA seqDB search
MKLVDLTADLQALLASPNVHHNLSAPKLTEKVISRNEGTLTSTGAVRATTGAYTGRSPKD
KFIVREQSTENQIDWGAVNQPISEEAFEKLYAKVVSYLKQRDELFVFEGFAGADEKYRLP
ITVVNEFAWHNLFARQLFIRPETDERDPQAQPFTILSAPHFKADPETDGTHSETFIIVSF
EKRVILIGGTEYAGEMKKSIFSIMNFLLPQQDILPMHCSANVGEKGDVALFFGLSGTGKT
TLSADADRKLIGDDEHGWSDSGVFNIEGGCYAKCINLSEEKEPQIFRAIRFGSVLENVVL
DEKTGEADYDNSFYTENTRAAYPIEMIGNIVQPSIAGHPQAIVFLTADAFGVLPPISKLT
KEQAMYHFLSGYTSKLAGTERGVTSPQTTFSTCFGSPFLPLPAHVYAEMLGHKIDEHGVQ
VFLVNTGWTGGGYGVGERMKLSYTRAMVKAAIEGRLNQTDMTADSIFGLRSPVHVPGVPD
EVLQPENTWSDKQAYNEKALFLANEFKENFKKFSHADSIAKAGGPLV
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagttgatttaaccgcagatcttcaagcattacttgcaagtccgaatgtgcat
cataatttatcggctccaaaacttaccgaaaaagtgatcagccgaaatgaaggaacgctg
acatcaacgggcgccgtacgcgccaccaccggcgcttatacaggcaggtcacctaaagat
aaatttatcgtccgtgaacaaagcacagaaaatcaaattgattggggcgcggtgaatcag
cccatttctgaagaggcgtttgaaaagctgtacgccaaagtcgtcagctacttaaaacag
cgggatgaactgtttgtttttgaaggattcgcaggagcggatgaaaaatacagactcccg
attacggtcgtaaatgaatttgcatggcacaatttattcgcacgccagctgtttatcaga
ccggagacggatgaaagagatccgcaagcgcagcctttcaccattctctcggctccgcat
tttaaagcagatccggagacggacggcacgcattcggaaacatttatcattgtctctttc
gaaaagcgcgtcattttaatcggcggcaccgaatacgccggagaaatgaaaaaatcaata
ttctccattatgaacttcctgcttccgcagcaggatatactgccgatgcactgctcagcc
aatgtcggtgaaaaaggcgatgtcgccctgtttttcggtctttccggcacagggaaaacg
acgctttcagccgatgcggaccgcaaactgatcggcgatgacgagcacggctggtcagat
tccggcgttttcaacattgaaggcggatgttacgctaaatgtatcaatctgagcgaggaa
aaagaaccgcagatttttcgtgcgatccgcttcgggtctgttcttgagaatgtcgtgctt
gatgaaaaaacgggtgaagcggattacgataattccttctacacggaaaacacaagagcc
gcatatccgattgagatgatcggcaatatcgtgcagccgagcattgccggccatccgcag
gcaatcgtctttttaacggcggacgcattcggtgtgctccctccgatcagcaaactgacg
aaggaacaggcgatgtatcacttcttaagtgggtacaccagtaaactcgcgggaaccgag
cgcggcgtgacatctccgcaaacgactttctcgacgtgcttcggttcaccgttccttccg
cttccggcgcatgtatatgccgaaatgctcgggcataaaatcgacgaacacggcgttcaa
gtcttcctggtcaacacaggctggaccggcggagggtacggagtcggagaacggatgaaa
ctttcgtatacaagagcgatggtcaaggccgctattgaaggcagactgaaccagactgac
atgacggcagacagcattttcggcctgcgcagtcccgttcatgttccgggcgttccggat
gaagttcttcagcctgaaaacacatggagcgataaacaagcatacaacgaaaaagcgctg
tttttagccaatgagtttaaagaaaactttaaaaagttttcccatgcagactcgattgcc
aaagccggcggacctctcgtgtaa

DBGET integrated database retrieval system