KEGG   Bacteroidales bacterium CF: BRDCF_p1098Help
Entry
BRDCF_p1098       CDS       T02861                                 

Gene name
pit
Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bacc  Bacteroidales bacterium CF
Brite
KEGG Orthology (KO) [BR:bacc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BRDCF_p1098 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGY53725
UniProt: U5Q8M9
Position
1309080..1310111
Genome map
AA seq 343 aa AA seqDB search
MLTIVIIAIVVALLFDFLNGMNDAANSIATIVSTRVLSPTAAVLWAAFWNFAAFFIFGVH
VANTIGKGIVDPNVVNPYIILSALSGSVIWVYACTKLGMPISVSHALIGGLIGPVWFTHG
TSALIGTGILKIGIFIVLSPLIGSILGFIMMAITLFIHKNKHPLKVEKRFKVMQLFSSAI
FSLGHGGNDAQKTMGIIAMLLFSVAGSNEFIAKYLYEPGVGFHVPLWITITCYSVIALGT
ITGGWKVIRTLGDGLAKLKPVQGFCAETAGALTLIGTALTGIPVSTTHTITGSIIGVGMT
KGVATVKWATAKNIVGAWIFTIPASLLISGLIYVVIEAILVLP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgttgacaatagtcataatagcaatagttgtagcccttctgtttgattttctcaacgga
atgaatgatgctgcaaactcaattgcaacaatagtttctactagagtcctctccccgact
gccgccgtgctttgggctgcattctggaattttgccgcatttttcatcttcggagtacat
gttgccaataccataggtaaaggtattgtagatccgaatgttgttaatccctatataatt
ttatctgctctaagtggttctgtaatatgggtatacgcctgtaccaaactgggtatgccg
ataagtgtatcgcacgcattgattggaggacttatcggtccggtgtggtttactcatggc
accagcgctcttataggaacagggatacttaaaatcggcatttttatagtactctctcct
ttgattggttcgatacttggctttataatgatggccatcactcttttcattcacaaaaac
aagcatccgttgaaggttgaaaagagattcaaggttatgcaacttttctcctctgcaata
ttcagtctgggacacggaggcaacgatgcccagaaaactatgggtattattgccatgtta
ctgttcagtgttgccgggagtaatgagtttatcgcaaaatatctatatgaaccgggcgtt
gggtttcacgtaccactctggattacaatcacatgctactccgtaattgcattaggaaca
attacaggcggatggaaggttatcaggactctcggagatggtctggctaaattaaaacct
gtacaaggtttctgtgcagagactgccggtgcattgacactaataggtacagcccttaca
ggtattccagtcagcacaactcatacaattacgggttctattatcggcgtcggtatgaca
aaaggggttgcaacagttaaatgggcaacagccaaaaacatcgtaggggcatggattttc
accataccggccagccttcttatttccggtcttatatacgtagttattgaagcaatactg
gttttgccttag

DBGET integrated database retrieval system