KEGG   Bacteroidales bacterium CF: BRDCF_p2308Help
Entry
BRDCF_p2308       CDS       T02861                                 

Gene name
ltaE
Definition
(GenBank) Low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bacc  Bacteroidales bacterium CF
Pathway
bacc00260  Glycine, serine and threonine metabolism
bacc01100  Metabolic pathways
bacc01110  Biosynthesis of secondary metabolites
bacc01120  Microbial metabolism in diverse environments
bacc01130  Biosynthesis of antibiotics
bacc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bacc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BRDCF_p2308 (ltaE)
Enzymes [BR:bacc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BRDCF_p2308 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 Aminotran_3 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGY54935
UniProt: U5QBY8
Position
2653550..2654587
Genome map
AA seq 345 aa AA seqDB search
MLHSFGSDNHSGAAPEIIEAIINANKDFSEAYGEDKTTKQANILFKKILGDKAESFFVFN
GTGANVVALKALTKTHNSILCPETAHINVDECGAPEKATGCKLIPLTAKDGKVTPEEVKK
ELKNFGFQHHSQVKVLSISQPTELGTLYTPQEIKELADLMHEHNCYLHIDGSRISNASAA
LGLPIKNFTADAGVDALSFGGTKNGLLIGEAVIFFKKELSEDFLYIRKQNTQLFSKNRFI
AAQFIAYLKDGLNIRLAAHSNTMAKYLESTLKEIPEIEISRPVETNAVFAIIPQYLCNEL
LKKHLFYVWDETTNEVRWMCSFNTTREDIDTFVNDIIRIVTANKI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgttacacagttttggaagtgataatcattcaggggcagctcctgaaattatagaagca
ataataaatgccaacaaagatttttctgaggcatacggagaggataaaaccacaaaacaa
gccaatatcctgtttaaaaagattttaggtgataaagccgaatctttttttgtttttaat
gggaccggtgcaaatgttgttgctctgaaggcgcttacaaaaactcacaattctatactt
tgtccggaaactgcgcatataaatgtagatgagtgcggagctcccgaaaaggctaccgga
tgtaaacttattccattaacagctaaagatggtaaagtaactcctgaagaggtaaaaaaa
gagttgaagaatttcggttttcaacaccattcacaggtcaaggtactctctatatcacaa
cctactgaattaggcacactttacaccccgcaggagataaaagaactggcagatctcatg
catgaacataactgttatctgcatatagacggatcaagaatttcaaatgcctctgcggct
ctcggtttgccaataaaaaacttcactgcagatgccggagtcgatgccctatccttcggc
ggaacaaaaaatggccttttgatcggagaggcagtaatcttttttaagaaggaactttca
gaagattttttatatatccgaaaacaaaacacacaactcttttcaaaaaatcgtttcatt
gcagctcagtttatagcctatctcaaagatggactgaacattaggctcgcggcacactct
aatactatggctaagtacctggaatcaacgttgaaagagataccggaaatagagattagc
cgtcctgttgagacaaatgccgtttttgcaattatccctcaatacttgtgtaatgagttg
cttaagaaacatctattttatgtatgggacgaaacaacaaatgaggtccgctggatgtgc
tcattcaacacaaccagagaggacattgacacctttgtaaatgatattattagaatagta
actgcaaataaaatttaa

DBGET integrated database retrieval system