KEGG   Bacillus sp. 1NLA3E: B1NLA3E_00130Help
Entry
B1NLA3E_00130     CDS       T02643                                 

Gene name
tmk
Definition
(GenBank) thymidylate kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00240  Pyrimidine metabolism
baci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baci00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    B1NLA3E_00130 (tmk)
Enzymes [BR:baci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     B1NLA3E_00130 (tmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylate_kin AAA_28 dNK AAA_17 AAA_18 AAA_22 AAA_16 AAA_30 ABC_tran NTPase_1 AAA AAA_19 Cytidylate_kin AAA_25 ATP_bind_1 APS_kinase AAA_23 AAA_33 AAA_24 AAA_14 TsaE ATPase_2 SRP54 RuvB_N RsgA_GTPase MMR_HSR1 RNA_helicase Zeta_toxin cobW
Motif
Other DBs
NCBI-ProteinID: AGK51810
UniProt: N0AUT9
Position
39538..40164
Genome map
AA seq 208 aa AA seqDB search
MGKGVFITIEGPEGAGKTTIINMLAQHLESVGYPVMQTREPGGIEIAEQIREVILATENT
AMDPRTEALLYAAARRQHLIEKVKPALESGAVILCDRFIDSSLAYQGYARGLGIDEVYTI
NEFAIEDMMPKLTLYFDIDPEQGLKRINQHKGREVNRLDLETIDFHQKVREGYQLLITRF
PKRIQLIDASKSVESVFNQALIKIREIL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaggtgtatttattacaattgaggggcctgagggtgccggtaaaacaacgata
atcaatatgttagcgcaacatttagaaagtgtagggtatccggttatgcaaacaagggag
cctggaggaatagaaatcgctgaacaaatccgtgaggtcattttagcaaccgaaaatacg
gcaatggatccacgaacagaagctttgttatatgctgcggccagaagacagcatttaata
gaaaaggttaagccagctctagaatctggggcggtaattttgtgtgatcggtttatcgat
agttccctagcataccaaggttatgcgcgcggtttgggaatcgacgaggtatatactatt
aatgagtttgcaattgaggatatgatgcctaagctaacgctttattttgatattgatcct
gaacaaggactgaagcggatcaaccaacataaaggtcgtgaagtgaatcggttggattta
gaaacaattgattttcatcaaaaggttagagagggttatcaacttttgataactaggttt
ccaaagcgtattcaactaattgatgcatcaaagtcagtggaatcagtattcaatcaggca
ttaatcaaaatcagggaaatactataa

DBGET integrated database retrieval system