KEGG   Bacillus sp. 1NLA3E: B1NLA3E_00565Help
Entry
B1NLA3E_00565     CDS       T02643                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci03010  Ribosome
Brite
KEGG Orthology (KO) [BR:baci00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    B1NLA3E_00565 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:baci03011]
    B1NLA3E_00565 (rplV)
Ribosome [BR:baci03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    B1NLA3E_00565 (rplV)
  Bacteria
    B1NLA3E_00565 (rplV)
  Archaea
    B1NLA3E_00565 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGK51897
UniProt: N0AP58
Position
136227..136568
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKARLVVDLIRGKQVGEAVAILKLTPKAASPIVEKVLKSAMANAEH
NYEMDINSLVVEQAYVNEGPTLKRFRPRAMGRASAINKRTSHIIIVLSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagctgttgcaagaacagttcgtattgctcctcgtaaagctcgtttagtc
gtagatttaattcgaggtaagcaagtaggtgaagcagtagcgattttaaagttaactcca
aaagctgcttctccaatcgtagaaaaagtattaaaatctgctatggcaaacgctgagcat
aactacgaaatggatatcaattcattagttgttgagcaagcatatgtaaacgaaggacca
acgttaaaacgtttccgtcctcgtgcgatgggccgtgcaagcgcgataaacaaacgtact
agccatattatcatcgttttatcagaaaagaaggagggataa

DBGET integrated database retrieval system