KEGG   Bacillus sp. 1NLA3E: B1NLA3E_01975Help
Entry
B1NLA3E_01975     CDS       T02643                                 

Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00860  Porphyrin and chlorophyll metabolism
baci01100  Metabolic pathways
Module
baci_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:baci00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B1NLA3E_01975
Enzymes [BR:baci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     B1NLA3E_01975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AGK52179
UniProt: N0ALA7
Position
435985..436596
Genome map
AA seq 203 aa AA seqDB search
MQIIFVRHGQTDENAANRYLGHTDPSLNDLGRQQIVNFTKQFPVYFSENITSFYSSDLKR
AQETAQIIRTSLLLNPPTPVPSLREMNFGDWECMTYERIMETNPVLVTSWVDNPFEVSPP
NGETLLALGARFDTWLKQILHQAGDVENILIVCHGGPIRWFRSKWLQGDPKQFWNIEGIK
HGTGIVVQYDKQTQEFSTVKFVT
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattatttttgttagacatggacaaacggatgagaatgctgctaatcgttatctg
ggacatactgatccttccttaaacgacctaggaaggcagcaaattgtaaatttcactaag
caatttccggtttattttagtgaaaatattacctcattttactctagtgatttaaaaaga
gctcaagagactgcacaaattattaggactagtttattgctcaatccacccactccagta
ccctcacttcgagagatgaattttggggactgggagtgtatgacgtatgaacgaatcatg
gagaccaatccagttctagtgacttcttgggtcgataatccgtttgaggtttctcctcct
aatggtgaaaccctgctcgctcttggggcgcgttttgatacttggttaaaacagatattg
catcaagcaggtgatgttgaaaatattttaattgtctgtcatggtggtccgatccggtgg
tttaggagtaagtggctccagggtgatccaaaacagttttggaatattgaagggattaaa
cacgggactggaatagtcgttcaatatgataagcaaacacaagagtttagtacagtaaag
ttcgttacatag

DBGET integrated database retrieval system