KEGG   Bacillus sp. 1NLA3E: B1NLA3E_05345Help
Entry
B1NLA3E_05345     CDS       T02643                                 

Definition
(GenBank) PAP2 family protein
  KO
K19302  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:baci00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B1NLA3E_05345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:baci01011]
    B1NLA3E_05345
Enzymes [BR:baci01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     B1NLA3E_05345
Peptidoglycan biosynthesis and degradation proteins [BR:baci01011]
 Precursor biosynthesis
  Diphosphatase
   B1NLA3E_05345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAP2 PAP2_3 PAP2_C
Motif
Other DBs
NCBI-ProteinID: AGK52839
UniProt: N0ANI7
Position
1185794..1186309
Genome map
AA seq 171 aa AA seqDB search
MNNKVFKLINRFSGRCSPMDLLMILISNKIRYVFIFVLIFMWFRNDSYKKVSYNAVKSMG
ITLFIHTLIKLFYFKPRPFVKHRVGILIPSKMDSTFPSKHTLLVFAISTSIFLYDRVLGS
VMWVLSVLTGFSRIWVGHHYPSDIIGSAFIATMTSTILEKISSSVNYFVRQ
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataaagtatttaagttaatcaatcggttttctggacgttgttctccaatggat
ttgctgatgatattgatttcaaataaaattcgttatgtatttatttttgtattgattttc
atgtggtttagaaatgattcctacaaaaaagtgtcttataatgcggtgaaatctatgggg
attacattgtttattcatactttaattaaattgttttattttaaaccacgtccttttgtg
aaacatcgtgtcggcatacttattccttcaaaaatggattctacatttccaagtaaacat
actttgctagtatttgctatatctacttctatctttctttatgaccgtgtcctcggttca
gtcatgtgggtattatcagtattgacgggcttctcccgtatttgggtagggcatcattat
ccatctgatattatcggaagtgcctttatcgccaccatgaccagcaccatattagaaaaa
atctctagcagtgttaattattttgtccgtcaatag

DBGET integrated database retrieval system