KEGG   Bacillus sp. 1NLA3E: B1NLA3E_05505Help
Entry
B1NLA3E_05505     CDS       T02643                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00260  Glycine, serine and threonine metabolism
baci01100  Metabolic pathways
baci01110  Biosynthesis of secondary metabolites
baci01120  Microbial metabolism in diverse environments
baci01130  Biosynthesis of antibiotics
baci01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baci00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B1NLA3E_05505
Enzymes [BR:baci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     B1NLA3E_05505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Pyridoxal_deC DUF2203 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AGK52867
UniProt: N0AS47
Position
1223725..1224747
Genome map
AA seq 340 aa AA seqDB search
MIIDFRTDAGTRPTEEMRKAMYNAEVGDDVFREDPSVNRLEETAAEMLGKEAALFVTSGT
MGNQLAILSQTSPGSEILVEEHSHIFVQEAASHSIIAGVQTRPISSDKGTLDPERVRSAI
RMPGESTYTSLLCLENTHNYSGGTIVPLDNIKDLYSICRKSGTKLHIDGARLFNAVVATS
ISVDEYAQYSDTVQICLCKGLGAPIGAILAGSQECIANARNWRKRLGGAMPQAGVIAAPA
LVALTSMVERLNEDHEKAKKLAEGLIQIPGITVELETVQTNIVMANVQGTGKSVRELIYE
LKAVGILATEFTAGVLRFVTHKDISQADIDEALKRIKNLL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgattatagattttagaacagatgctggtactcgaccaacggaagaaatgcgtaaagca
atgtataatgccgaagtgggagatgacgtttttagagaggatccatcagttaatcgttta
gaggaaacagcagcagaaatgttgggaaaagaggctgctttgtttgtcacttcaggcaca
atgggaaatcaactagccatattatctcaaacatcaccaggttcagaaattctggtggaa
gaacattcacatatctttgttcaagaagcagcttctcattctattattgctggcgttcag
acacggcccatttctagtgataaaggcacattagatccagaacgagtgcgtagtgccatt
agaatgcctggagagtcaacatatactagtctcctatgcttagaaaatacacataactat
tcaggtggcacaattgtacctttagataatatcaaggacttgtattctatttgtcgtaaa
tccggtaccaagttacatattgatggtgcaagactgtttaatgccgttgttgccacatct
atttcagtcgatgaatacgcacaatattccgataccgtccaaatttgtttatgtaaaggc
ttaggagctccaataggtgctattctcgcaggttcgcaagagtgtattgctaatgcaaga
aattggcgtaaaagactaggtggagcaatgccccaagcaggggttatagctgcacctgct
ctagtagcattaacaagtatggtagaacgattgaatgaggaccacgaaaaagctaaaaaa
ttagcagaagggttaattcaaatacctggtattaccgtggagttggaaactgttcagacg
aatattgttatggcaaatgttcaaggaacaggaaagtcagttcgagaactgatttacgaa
ctaaaggcagttggaatattagcaactgaattcacagccggtgttttacggtttgttacg
cataaagatatctctcaggctgatatagatgaggcattaaaacgtattaagaaccttctt
taa

DBGET integrated database retrieval system