KEGG   Bacillus sp. 1NLA3E: B1NLA3E_06100Help
Entry
B1NLA3E_06100     CDS       T02643                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00471  D-Glutamine and D-glutamate metabolism
baci00550  Peptidoglycan biosynthesis
baci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baci00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    B1NLA3E_06100 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B1NLA3E_06100 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:baci01011]
    B1NLA3E_06100 (murD)
Enzymes [BR:baci01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     B1NLA3E_06100 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:baci01011]
 Precursor biosynthesis
  Amino acid ligase
   B1NLA3E_06100 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Pyr_redox_3 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AGK52984
UniProt: N0AP15
Position
1331827..1333179
Genome map
AA seq 450 aa AA seqDB search
MRKIEQYRHKKVLVLGLAKSGVSAASLLHKLGAFVTVNDKKPLSENPEGQGLLEQGIKVV
CGDHPIELLDEGFELIVKNPGIPYRNPLIIGALDREIPVITEVELAYQISEAPFIGITGT
NGKTTTTTLIYEMLAADDKQPLIAGNIGTVASGVAEVAKADNTIVIELSSFQLMGIDTFR
PKIAILTNLYDAHLDYHESKQEYRDAKASITKNQTKDDYLIVNHDQIELVEIADKSKANV
IFFSTTKDLGTGAFIRDGWVMFEGEQVVKLVDIVLPGVHNLENILSAVAASKLSGVSNEA
IYHVLSTFKGVKHRLQFIGEKDGRRFYNDSKATNILATSKALAAFQAPIILLAGGLDRGN
SFDTLIPSLRNVKAMITFGQTAVKLEEAGRLAGIKEIKRVDNVDKAVPEAFKLSEKGDVI
LLSPACASWDQYKTFEVRGDIFIDAVHKLN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatcgaacaatatcgtcataaaaaggtcttagttttagggttagcaaaaagt
ggggttagtgccgcctcattactacataagctaggtgcatttgttactgtaaatgataaa
aaaccattatcagaaaatccagaaggtcaaggactgttagagcaaggaataaaggtggtt
tgtggggatcatccgattgagcttttagatgaggggttcgaattgattgtaaaaaatcca
ggaattccttatcgaaacccgctaattatcggagctttggacagagaaatacctgtcatt
actgaagtggagcttgcctatcaaatttccgaggcaccttttattggtattactggaact
aatgggaaaaccacgacaacaactcttatttacgagatgcttgctgctgatgataaacag
ccgctgattgccggtaatatcggaacagttgcttctggtgttgctgaagtagcaaaggca
gataataccattgtcatcgagttatcgtcgtttcagctaatgggtattgatacatttaga
ccaaagattgctattttgactaatctgtatgatgcacatcttgattatcatgagtctaaa
caggaatatcgagatgcgaaagctagcatcaccaagaatcaaacaaaagatgactatcta
attgttaatcatgatcaaatagaacttgttgagattgcggataaatcaaaagcaaacgtg
atctttttctcgacaaccaaagatctaggaacaggtgcatttatccgagatggttgggtc
atgttcgaaggcgaacaagtggttaagcttgtagacattgttttacctggtgttcataat
ttagagaatatcttatcagccgttgctgcttccaaattgagcggtgtttctaatgaagca
atatatcatgttttaagtacttttaaaggggttaaacatcgcctacagtttatcggagaa
aaggatggtagacgattttacaatgactcaaaagctacaaatattttggcaacatcaaaa
gcgctcgctgcatttcaagccccgattattttgcttgctgggggattggatcgcggaaac
agctttgatacgcttattccatctttacggaatgtaaaagctatgattacttttggccaa
acagcggtaaagttagaagaggcaggtaggcttgctggaataaaagaaattaaacgcgtc
gataatgttgacaaagcggtacctgaggcattcaagctttccgaaaagggcgatgttatt
ctattatctcctgcttgcgcaagttgggatcaatataaaactttcgaagtaagaggagac
atttttatagatgcagtgcataagcttaactaa

DBGET integrated database retrieval system