KEGG   Bacillus sp. 1NLA3E: B1NLA3E_13970Help
Entry
B1NLA3E_13970     CDS       T02643                                 

Definition
(GenBank) 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00360  Phenylalanine metabolism
baci00362  Benzoate degradation
baci00621  Dioxin degradation
baci00622  Xylene degradation
baci01100  Metabolic pathways
baci01120  Microbial metabolism in diverse environments
baci01220  Degradation of aromatic compounds
Module
baci_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:baci00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    B1NLA3E_13970
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B1NLA3E_13970
   00622 Xylene degradation
    B1NLA3E_13970
   00621 Dioxin degradation
    B1NLA3E_13970
Enzymes [BR:baci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     B1NLA3E_13970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm ComA Glyco_trans_4_5
Motif
Other DBs
NCBI-ProteinID: AGK54540
UniProt: N0B2W3
Position
complement(3059721..3060746)
Genome map
AA seq 341 aa AA seqDB search
MTNTRDILITEVALRDGSHAIAHQYTVEQVLKVAKALNDAGVPYIEVSHGDGLSGSSLQY
GLSRTNEMELIEASVSVADKAKIAVLLLPGIGTVKELKEAAKLGVKMARVATHVTEADVS
AQHIQVAKELGLETVGFLMMAHMAPVEKLVEQAKLMESYGADTVYVVDSAGTLLPDGVRE
RIRAMKQELNVKIGFHGHNNLSLAMANTIIAIEEGATHIDGSVRCLGAGAGNTQTEVLVA
VLDRMGIKTGVDSYKMMDVAEDIVAPILQSPQEITRDSLVLGYAGVYSSFALHAKRAATK
YGIDSRDILVELGKRKAVGGQEDMIVDVAAEIAKTKAAAIR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatacacgggatattttaattactgaggtagctttgcgtgatggcagccacgct
attgcccatcaatatacagttgaacaggttttaaaagtagcgaaagcgttaaatgatgct
ggggttccttatattgaggtatcacatggggatggtctttcgggttcctccctgcaatat
ggtctttcgcgtacgaatgaaatggagttaattgaagcgtccgtttccgttgctgacaag
gcgaaaattgcggttcttttgctgcctgggattggcacggtcaaagaactaaaagaagct
gcgaaactgggagtgaaaatggcacgggttgccactcatgtgacagaagccgatgtatct
gcgcagcatattcaagtggccaaagaattagggttggaaacagtcggctttttgatgatg
gcccatatggcaccagttgaaaaattggttgagcaggcgaagttaatggagagctatgga
gcagataccgtttatgttgttgattctgcaggtacattgcttcctgatggggttcgcgag
cgcattcgtgcaatgaaacaggagctaaatgtcaaaataggttttcatggacataacaac
ttgtctcttgcaatggcaaatacaataattgctattgaagagggggcaacacacattgac
ggcagtgttcgctgtttaggtgcaggagcaggcaatacacaaacagaggtgctggtggcc
gtccttgatcggatggggatcaaaacgggtgtggatagttacaaaatgatggatgtagcc
gaagacattgttgcgcctattttgcaatcgccgcaagagattactagagacagtcttgtg
cttggatacgccggtgtttattccagctttgcgcttcatgccaaaagggctgcaaccaaa
tacggtattgattcacgtgatatcttagtagaattaggcaagcgtaaagcagtcggaggt
caagaggatatgattgtcgatgtcgcagcagaaatcgccaagacaaaggcagcggcgatt
cggtga

DBGET integrated database retrieval system