KEGG   Bacillus sp. 1NLA3E: B1NLA3E_13975Help
Entry
B1NLA3E_13975     CDS       T02643                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00360  Phenylalanine metabolism
baci00362  Benzoate degradation
baci00620  Pyruvate metabolism
baci00621  Dioxin degradation
baci00622  Xylene degradation
baci00650  Butanoate metabolism
baci01100  Metabolic pathways
baci01120  Microbial metabolism in diverse environments
baci01220  Degradation of aromatic compounds
Module
baci_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:baci00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B1NLA3E_13975
   00650 Butanoate metabolism
    B1NLA3E_13975
  Amino acid metabolism
   00360 Phenylalanine metabolism
    B1NLA3E_13975
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B1NLA3E_13975
   00622 Xylene degradation
    B1NLA3E_13975
   00621 Dioxin degradation
    B1NLA3E_13975
Enzymes [BR:baci01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     B1NLA3E_13975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh DapB_N GFO_IDH_MocA TrkA_N F420_oxidored CoA_binding Spore_GerAC ADH_zinc_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AGK54541
UniProt: N0B1P9
Position
complement(3060768..3061655)
Genome map
AA seq 295 aa AA seqDB search
MSKVKVAILGSGNIGTDLMIKLERSDILELTAVIGIDPESDGLKLARELGYLAVDTGLEG
FLEYHADLADIVFDATSAKAHVRHAKLLKEAGIKAIDMTPAARGPFVVPSVNMGSNITAE
NINLITCGGQATIPMVYAVNHVIPVEYAEIVATISSRSAGPGTRENIDEFTETTSRGIVE
VGGAKKGKAIIILNPAEPPIMMRDTVYCLVEKGAIDEAKIIESIQKMEKTVQSYVPGYRL
RTEPIIEGNKVTIFIEVEGAGDYLPKYTGNLDIMTAAGVKVAEEFAKNQLAKQIV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaaaagtaaaagttgcaatacttggttcagggaatattggaaccgacctcatgatt
aaactagaacgatcagatattttggagcttaccgctgtgataggaattgacccggaatca
gatggtctaaagctggcgagagaattagggtatttagctgttgatacaggcctagaggga
tttctcgaatatcacgccgacttagcggatatcgtttttgatgccacatctgcgaaggca
catgtccgacatgccaaattgttaaaggaagcggggatcaaggccattgatatgactcca
gcagctagggggccgtttgttgtgccctctgtcaatatggggtccaatattaccgctgaa
aatattaacttgattacctgcggtggtcaggcgactatcccgatggtctatgcggtaaac
catgtgattcctgtcgaatatgctgaaatcgttgccactatttccagccgcagcgcagga
ccaggaacacgggagaacattgatgagtttacggaaaccacttcacgggggatcgttgaa
gttggaggagcaaagaaaggcaaggcgattattattctaaatccggcagaaccgccgatt
atgatgcgtgataccgtatattgccttgtggaaaaaggagcgatagatgaagcaaaaatt
atcgagtccattcaaaaaatggagaaaactgttcaatcttacgtccctggatatcgtctc
cgaactgagccaatcatcgaggggaataaagtgacgatttttatcgaagtggaaggcgca
ggtgattacctgccaaaatataccggaaaccttgatattatgaccgctgcgggggtaaaa
gtggcagaagaatttgcaaaaaatcaattagcgaaacagatagtctaa

DBGET integrated database retrieval system