KEGG   Bacillus sp. 1NLA3E: B1NLA3E_18745Help
Entry
B1NLA3E_18745     CDS       T02643                                 

Definition
(GenBank) cysteine desulfurase SufS
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
baci  Bacillus sp. 1NLA3E
Pathway
baci00450  Selenocompound metabolism
baci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baci00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    B1NLA3E_18745
Enzymes [BR:baci01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     B1NLA3E_18745
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     B1NLA3E_18745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 SelA Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGK55493
UniProt: N0AXX8
Position
complement(4044618..4045847)
Genome map
AA seq 409 aa AA seqDB search
MNIHDIRNLFPILDQEINGKPLVYLDSAATSQKPVQVIEAIDRYYREINSNVHRGVHTLG
TRATDAYEGAREKVRKFINAKSIQEIVFTRGTTTSLNTVARSYGGANLHPGDEIVISLME
HHSNIIPWQQVAKQTGATLKYLPMQEDGTISLDDVRATVTANTKIVSVMQVSNVLGTINP
VKEIAKIAHENGAIMVVDGAQSVPHMKIDVQDLDCDFLAFSGHKMCGPTGIGVLYGKKHL
LEKMEPVEFGGEMIDFVDLYDSTWKELPWKFEGGTPIIAGAIGLGAAIDFLEEVGLEQIL
AHEHRLAAYGMEKMSQIEGITIYGPKDPKNRAGVITFNINDVHPHDVATVLDAEGIAVRA
GHHCAQPLMKWLKASATARASFYLYNTEEDIDKLVEGLVKTKEYFSDVF
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgatattcgcaacctttttccaatactagatcaagaaataaacgggaaa
ccacttgtttatcttgacagtgccgctacatcacagaagccagttcaggtaatcgaggcc
atcgaccgctactatcgtgaaattaactccaatgttcatcgcggcgttcacacccttggg
actcgtgctacggatgcctatgaaggtgctcgtgaaaaggttcgtaagtttattaatgct
aaatcgattcaggaaattgttttcactcgggggacaacaacttcattaaatacagttgca
agaagttatggtggggctaaccttcaccctggtgatgaaattgtcatttctttaatggaa
catcacagtaatatcattccttggcagcaagtggcgaaacaaactggtgcaacacttaaa
tacctaccaatgcaagaagatggaaccatttcacttgatgatgttcgggcaaccgtgaca
gcaaatacaaaaattgtttctgttatgcaagtttccaatgttttaggaaccataaaccca
gtgaaggaaattgccaaaattgcccacgaaaacggtgctattatggtggttgacggagct
caaagtgtaccgcatatgaaaattgatgtgcaagatttagattgtgactttttagccttt
tcaggtcataaaatgtgcggtccaacgggtatcggcgtattatatggtaaaaagcatttg
cttgaaaaaatggagccagttgaatttggtggggaaatgatcgattttgtagatctttat
gattcaacatggaaagagcttccatggaagtttgaaggtggtactccaatcattgctgga
gcgattggactaggtgctgcgatcgactttttagaagaagttggattagagcaaattctc
gcacacgagcatagactagcagcatatggaatggaaaaaatgtcacagattgagggaatc
accatctacggtccgaaagatccaaaaaatcgtgccggtgtaattacctttaatataaat
gatgttcatccacatgatgtagcaactgttttagatgcggaaggaattgcagtccgtgca
ggacatcattgtgctcaacctttaatgaaatggttaaaggcatcagcaaccgctcgggcc
agcttctatttgtataatacggaagaggatattgataagctcgtcgaagggcttgttaaa
acaaaggagtatttcagcgatgtcttttaa

DBGET integrated database retrieval system